https://github.com/aws/aws-sdk-net
Score: 30.657377647190017
Last synced: about 4 hours ago
JSON representation
Repository metadata:
The official AWS SDK for .NET. For more information on the AWS SDK for .NET, see our web site:
- Host: GitHub
- URL: https://github.com/aws/aws-sdk-net
- Owner: aws
- License: apache-2.0
- Created: 2012-01-23T23:50:43.000Z (over 14 years ago)
- Default Branch: main
- Last Pushed: 2026-06-17T19:27:13.000Z (3 days ago)
- Last Synced: 2026-06-18T05:04:17.156Z (3 days ago)
- Language: C#
- Homepage: https://aws.amazon.com/sdk-for-net/
- Size: 1.9 GB
- Stars: 117
- Watchers: 7
- Forks: 885
- Open Issues: 45
-
Metadata Files:
- Readme: README.md
- Changelog: changelogs/SDK.CHANGELOG.2015.md
- Contributing: CONTRIBUTING.md
- License: License.txt
- Notice: Notice.txt
Owner metadata:
- Name: Amazon Web Services
- Login: aws
- Email: open-source-github@amazon.com
- Kind: organization
- Description:
- Website: https://amazon.com/aws
- Location: United States of America
- Twitter:
- Company:
- Icon url: https://avatars.githubusercontent.com/u/2232217?v=4
- Repositories: 536
- Last Synced at: 2026-03-02T20:07:16.924Z
- Profile URL: https://github.com/aws
GitHub Events
Total
- Commit comment event: 6
- Create event: 742
- Delete event: 460
- Discussion event: 1
- Fork event: 36
- Issue comment event: 1122
- Issues event: 328
- Member event: 1
- Pull request event: 633
- Pull request review comment event: 1437
- Pull request review event: 1714
- Push event: 2214
- Release event: 287
- Watch event: 163
- Total: 9144
Last Year
- Create event: 311
- Delete event: 230
- Discussion event: 1
- Fork event: 10
- Issue comment event: 292
- Issues event: 142
- Member event: 1
- Pull request event: 224
- Pull request review comment event: 751
- Pull request review event: 748
- Push event: 1160
- Release event: 126
- Watch event: 46
- Total: 4042
Committers metadata
Last synced: 5 days ago
Total Commits: 0
Total Committers: 184
Avg Commits per committer: 84.864
Development Distribution Score (DDS): 0.353
Commits in past year: 2,282
Committers in past year: 29
Avg Commits per committer in past year: 78.69
Development Distribution Score (DDS) in past year: 0.171
| Name | Commits | |
|---|---|---|
| aws-sdk-dotnet-automation | g****n@a****m | 10105 |
| Steven Kang | s****g@a****m | 1467 |
| Norm Johanson | n****j@a****m | 1218 |
| Steve Roberts | s****e@a****m | 372 |
| Pavel Safronov | p****l@a****m | 266 |
| Daniel Pinheiro | d****n@a****m | 176 |
| Vellozzi | v****i@a****m | 169 |
| Milind Gokarn | g****m@a****m | 158 |
| Karthik Saligrama | s****m@a****m | 154 |
| Sattwik Pati | s****p@a****m | 127 |
| Bo Blodgett | b****d@a****m | 126 |
| Peter Song | p****g@a****m | 106 |
| Muhammad Othman | m****n@g****m | 101 |
| Johnny Hoffman | j****f@a****m | 76 |
| amazonwebservices | a****s@a****m | 76 |
| Alex Shovlin | s****a@a****m | 75 |
| ashdhin | a****n@a****m | 69 |
| Aaron Costley | c****a@a****m | 56 |
| Jim Flanagan | j****l@a****m | 55 |
| philip pittle | p****e@a****m | 39 |
| Weijia Mao | m****j@a****m | 33 |
| Sergey Klementiev | k****i@a****m | 32 |
| Matteo Prosperi | 4****i | 32 |
| Malhar Khimsaria | k****r@a****m | 27 |
| danielmarbach | d****h@o****t | 24 |
| Phil Asmar | p****r@g****m | 24 |
| Norm Johanson | N****n | 24 |
| Sruti Guhathakurta | s****a@g****m | 23 |
| Tyler Moore | t****e@a****m | 18 |
| Ganesh Jangir | j****g@a****m | 14 |
| and 154 more... | ||
Issue and Pull Request metadata
Last synced: about 17 hours ago
Total issues: 586
Total pull requests: 1,271
Average time to close issues: 10 months
Average time to close pull requests: 15 days
Total issue authors: 497
Total pull request authors: 85
Average comments per issue: 5.3
Average comments per pull request: 0.9
Merged pull request: 884
Bot issues: 0
Bot pull requests: 25
Past year issues: 76
Past year pull requests: 302
Past year average time to close issues: 29 days
Past year average time to close pull requests: 9 days
Past year issue authors: 71
Past year pull request authors: 26
Past year average comments per issue: 3.24
Past year average comments per pull request: 0.79
Past year merged pull request: 171
Past year bot issues: 0
Past year bot pull requests: 1
Top Issue Authors
- lyndaidaii (7)
- martincostello (7)
- danielmarbach (6)
- normj (6)
- paulomorgado (6)
- dscpinheiro (5)
- lonix1 (4)
- Dreamescaper (4)
- grsw92 (4)
- genifycom (4)
- alex-jitbit (3)
- smusenok (3)
- rittneje (3)
- SonalCalcey (3)
- madhub (3)
Top Pull Request Authors
- peterrsongg (246)
- dscpinheiro (157)
- normj (131)
- muhammad-othman (129)
- boblodgett (93)
- ashishdhingra (62)
- GarrettBeatty (54)
- AlexDaines (35)
- ashovlin (34)
- 96malhar (30)
- irina-herciu (30)
- danielmarbach (26)
- dependabot[bot] (25)
- stephentoub (20)
- philasmar (20)
Top Issue Labels
- bug (378)
- queued (182)
- p2 (167)
- feature-request (134)
- response-requested (133)
- s3 (104)
- closed-for-staleness (76)
- module/sdk-core (75)
- needs-triage (75)
- p1 (74)
- dynamodb (73)
- module/sdk-generated (58)
- credentials (41)
- p3 (35)
- needs-review (34)
- potential-regression (30)
- needs-reproduction (27)
- guidance (27)
- v4 (26)
- module/sdk-custom (26)
- documentation (25)
- service-api (14)
- pending-release (14)
- closing-soon (13)
- needs-investigation (11)
- Extensions (11)
- investigating (11)
- module/unity (10)
- needs-major-version (10)
- breaking-change (9)
Top Pull Request Labels
- v4 (339)
- SRA (33)
- dependencies (25)
- v3 (18)
- bug (13)
- p2 (12)
- queued (12)
- dynamodb (6)
- feature-request (6)
- pr/needs-review (4)
- response-requested (3)
- s3 (3)
- p1 (3)
- aot (2)
- module/sdk-custom (2)
- module/sdk-core (2)
- cross-sdk (2)
- low-effort (1)
- doc-apireference (1)
- pr/blocked (1)
- .NET (1)
- needs-major-version (1)
- credentials (1)
Package metadata
- Total packages: 100
-
Total downloads:
- nuget: 691,826,188 total
- Total dependent packages: 169 (may contain duplicates)
- Total dependent repositories: 0 (may contain duplicates)
- Total versions: 80,622
- Total maintainers: 1
nuget.org: awssdk.timestreaminfluxdb
This is the initial SDK release for Amazon Timestream for InfluxDB. Amazon Timestream for InfluxDB is a new time-series database engine that makes it easy for application developers and DevOps teams to run InfluxDB databases on AWS for near real-time time-series applications using open source APIs.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.7 (published 23 days ago)
- Last Synced: 2026-06-18T13:02:58.937Z (2 days ago)
- Versions: 440
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 84,787 Total
-
Rankings:
- Dependent repos count: 7.859%
- Average: 8.912%
- Dependent packages count: 9.965%
- Maintainers (1)
nuget.org: awssdk.extensions.netcore.setup
Extensions for the AWS SDK for .NET to integrate with .NET Core configuration and dependency injection frameworks.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.4 (published about 1 month ago)
- Last Synced: 2026-06-18T13:07:29.386Z (2 days ago)
- Versions: 96
- Dependent Packages: 111
- Dependent Repositories: 0
- Downloads: 256,866,674 Total
-
Rankings:
- Downloads: 0.099%
- Average: 10.918%
- Dependent repos count: 13.819%
- Dependent packages count: 18.835%
- Maintainers (1)
nuget.org: awssdk.cloudwatchlogs
Amazon CloudWatch is a monitoring service for AWS cloud resources and the applications you run on AWS. You can use Amazon CloudWatch to collect and track metrics, collect and monitor log files, and set alarms.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.27 (published 5 days ago)
- Last Synced: 2026-06-18T13:01:43.580Z (2 days ago)
- Versions: 1,400
- Dependent Packages: 22
- Dependent Repositories: 0
- Downloads: 126,848,211 Total
-
Rankings:
- Downloads: 0.141%
- Average: 11.819%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.ssooidc
This is an initial release of AWS Single Sign-On OAuth device code authorization service.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.4 (published 29 days ago)
- Last Synced: 2026-06-18T13:01:26.072Z (2 days ago)
- Versions: 1,148
- Dependent Packages: 9
- Dependent Repositories: 0
- Downloads: 61,521,451 Total
-
Rankings:
- Downloads: 0.397%
- Average: 11.904%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.apigateway
Amazon API Gateway helps developers deliver robust, secure and scalable mobile and web application backends. Amazon API Gateway allows developers to securely connect mobile and web applications to APIs that run on AWS Lambda, Amazon EC2, or other publicly addressable web services that are hosted outside of AWS.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.7 (published 30 days ago)
- Last Synced: 2026-06-18T13:07:35.325Z (2 days ago)
- Versions: 1,392
- Dependent Packages: 6
- Dependent Repositories: 0
- Downloads: 20,657,905 Total
-
Rankings:
- Downloads: 0.403%
- Average: 11.906%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.appconfig
Introducing AWS AppConfig, a new service that enables customers to quickly deploy validated configurations to applications of any size in a controlled and monitored fashion.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.4 (published 29 days ago)
- Last Synced: 2026-06-18T13:07:48.599Z (2 days ago)
- Versions: 1,149
- Dependent Packages: 5
- Dependent Repositories: 0
- Downloads: 14,331,954 Total
-
Rankings:
- Downloads: 0.458%
- Average: 11.925%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.applicationautoscaling
Application Auto Scaling is a general purpose Auto Scaling service for supported elastic AWS resources. With Application Auto Scaling, you can automatically scale your AWS resources, with an experience similar to that of Amazon EC2 Auto Scaling.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.3 (published 17 days ago)
- Last Synced: 2026-06-18T13:07:18.164Z (2 days ago)
- Versions: 1,368
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 10,232,056 Total
-
Rankings:
- Downloads: 0.472%
- Average: 11.929%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.elasticbeanstalk
AWS Elastic Beanstalk is an easy-to-use service for deploying and scaling web applications and services developed with Java, .NET, PHP, Node.js, Python, Ruby, Go, and Docker on familiar servers such as Apache, Nginx, Passenger, and IIS.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.4 (published 19 days ago)
- Last Synced: 2026-06-18T13:07:49.971Z (2 days ago)
- Versions: 1,374
- Dependent Packages: 1
- Dependent Repositories: 0
- Downloads: 9,835,284 Total
-
Rankings:
- Downloads: 0.477%
- Average: 11.931%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.redshift
Amazon Redshift is a fast, fully managed, petabyte-scale data warehouse solution that makes it simple and cost-effective to efficiently analyze all your data using your existing business intelligence tools.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.7 (published 18 days ago)
- Last Synced: 2026-06-18T19:32:13.500Z (2 days ago)
- Versions: 1,387
- Dependent Packages: 2
- Dependent Repositories: 0
- Downloads: 9,072,612 Total
-
Rankings:
- Downloads: 0.488%
- Average: 11.935%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.databasemigrationservice
AWS Database Migration Service (AWS DMS) can migrate your data to and from most widely used commercial and open-source databases such as Oracle, PostgreSQL, Microsoft SQL Server, Amazon Aurora, MariaDB, and MySQL. The service supports homogeneous migrations such as Oracle to Oracle, and also heterogeneous migrations between different database platforms, such as Oracle to MySQL or MySQL to Amazon Aurora.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.10 (published 19 days ago)
- Last Synced: 2026-06-18T13:02:02.309Z (2 days ago)
- Versions: 1,378
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 7,580,949 Total
-
Rankings:
- Downloads: 0.515%
- Average: 11.944%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.marketplaceentitlementservice
AWS Marketplace Entitlement Service enables AWS Marketplace sellers to determine the capacity purchased by their customers.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.6 (published 30 days ago)
- Last Synced: 2026-06-18T13:01:49.756Z (2 days ago)
- Versions: 1,316
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 7,222,565 Total
-
Rankings:
- Downloads: 0.516%
- Average: 11.944%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.route53domains
Amazon Route 53 is a highly available and scalable cloud Domain Name System (DNS) web service.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.5 (published 18 days ago)
- Last Synced: 2026-06-18T13:02:36.863Z (2 days ago)
- Versions: 1,367
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 12,242,512 Total
-
Rankings:
- Downloads: 0.524%
- Average: 11.946%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.kafka
Amazon Managed Streaming for Kafka (Amazon MSK). Amazon MSK is a service that you can use to easily build, monitor, and manage Apache Kafka clusters in the cloud.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.10 (published 30 days ago)
- Last Synced: 2026-06-18T13:03:07.176Z (2 days ago)
- Versions: 1,289
- Dependent Packages: 3
- Dependent Repositories: 0
- Downloads: 7,682,429 Total
-
Rankings:
- Downloads: 0.528%
- Average: 11.948%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.guardduty
Enable Amazon GuardDuty to continuously monitor and process AWS data sources to identify threats to your AWS accounts and workloads. You can add customization by uploading additional threat intelligence lists and IP safe lists. You can list security findings, suspend, and disable the service.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.22 (published 18 days ago)
- Last Synced: 2026-06-18T13:07:57.770Z (2 days ago)
- Versions: 1,353
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 7,019,094 Total
-
Rankings:
- Downloads: 0.53%
- Average: 11.949%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.shield
AWS Shield protects web applications from large and sophisticated DDoS attacks at Layer 3, 4 and 7. In addition AWS Shield provides visibility in attacks, and access to 24X7 DDoS Response Team.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.2 (published 18 days ago)
- Last Synced: 2026-06-18T13:07:56.774Z (2 days ago)
- Versions: 1,332
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 22,426,070 Total
-
Rankings:
- Downloads: 0.532%
- Average: 11.949%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.wafregional
AWS WAF (Web Application Firewall) Regional protects web applications from attack via ALB load balancer and provides API to associate it with a WAF WebACL.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.3 (published 17 days ago)
- Last Synced: 2026-06-18T13:03:29.412Z (2 days ago)
- Versions: 1,330
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 6,620,202 Total
-
Rankings:
- Downloads: 0.536%
- Average: 11.951%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.account
This release of the Account Management API enables customers to manage the alternate contacts for their AWS accounts. For more information, see https://docs.aws.amazon.com/accounts/latest/reference/accounts-welcome.html
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.5 (published 22 days ago)
- Last Synced: 2026-06-18T13:02:14.958Z (2 days ago)
- Versions: 873
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 4,973,738 Total
-
Rankings:
- Downloads: 0.659%
- Average: 11.991%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.pinpoint
Amazon Pinpoint makes it easy to run targeted campaigns to improve user engagement. Pinpoint helps you understand your users behavior, define who to target, what messages to send, when to deliver them, and tracks the results of the campaign.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.3 (published 18 days ago)
- Last Synced: 2026-06-18T19:31:10.396Z (2 days ago)
- Versions: 1,345
- Dependent Packages: 1
- Dependent Repositories: 0
- Downloads: 6,567,919 Total
-
Rankings:
- Downloads: 0.793%
- Average: 12.036%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.simpledb
Amazon SimpleDB is a highly available, scalable, and flexible non-relational data store that enables you to store and query data items using web services requests.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.0 (published about 1 year ago)
- Last Synced: 2026-06-18T13:03:00.309Z (2 days ago)
- Versions: 1,350
- Dependent Packages: 1
- Dependent Repositories: 0
- Downloads: 3,137,394 Total
-
Rankings:
- Downloads: 0.972%
- Average: 12.096%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.docdb
Amazon DocumentDB is a fast, reliable, and fully managed MongoDB compatible database service.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.6 (published 19 days ago)
- Last Synced: 2026-06-18T13:01:52.607Z (2 days ago)
- Versions: 1,272
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 2,749,376 Total
-
Rankings:
- Downloads: 1.085%
- Average: 12.134%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.sagemakerruntime
Amazon SageMaker is a fully-managed service that enables data scientists and developers to quickly and easily build, train, and deploy machine learning models, at scale.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.4 (published 8 days ago)
- Last Synced: 2026-06-18T13:02:37.675Z (2 days ago)
- Versions: 1,308
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 3,581,006 Total
-
Rankings:
- Downloads: 1.322%
- Average: 12.212%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.awshealth
The AWS Health API serves as the primary source for you to receive personalized information related to your AWS infrastructure, guiding your through scheduled changes, and accelerating the troubleshooting of issues impacting your AWS resources and accounts.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.6 (published 19 days ago)
- Last Synced: 2026-06-18T13:07:15.787Z (2 days ago)
- Versions: 1,332
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 1,278,697 Total
-
Rankings:
- Downloads: 1.35%
- Average: 12.222%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.chime
The Amazon Chime API (application programming interface) is designed for administrators to use to perform key tasks, such as creating and managing Amazon Chime accounts and users.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.3 (published 22 days ago)
- Last Synced: 2026-06-18T13:07:15.419Z (2 days ago)
- Versions: 1,300
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 1,266,796 Total
-
Rankings:
- Downloads: 1.388%
- Average: 12.234%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.servicediscovery
AWS Cloud Map lets you configure public DNS, private DNS, or HTTP namespaces that your microservice applications run in. When an instance of the service becomes available, you can call the AWS Cloud Map API to register the instance with AWS Cloud Map. For public or private DNS namespaces, AWS Cloud Map automatically creates DNS records and an optional health check. Clients that submit public or private DNS queries, or HTTP requests, for the service receive an answer that contains up to eight healthy records.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.3 (published 25 days ago)
- Last Synced: 2026-06-18T13:07:54.524Z (2 days ago)
- Versions: 1,315
- Dependent Packages: 4
- Dependent Repositories: 0
- Downloads: 2,215,209 Total
-
Rankings:
- Downloads: 1.403%
- Average: 12.24%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.redshiftdataapiservice
The Amazon Redshift Data API is generally available. This release enables querying Amazon Redshift data and listing various database objects.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.5 (published 23 days ago)
- Last Synced: 2026-06-18T13:06:06.045Z (2 days ago)
- Versions: 1,015
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 2,220,028 Total
-
Rankings:
- Downloads: 1.406%
- Average: 12.241%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.costandusagereport
The AWS Cost and Usage Report Service API allows you to enable and disable the Cost and Usage report, as well as modify the report name, the data granularity, and the delivery preferences.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.2 (published 19 days ago)
- Last Synced: 2026-06-18T13:07:58.709Z (2 days ago)
- Versions: 1,323
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 1,024,040 Total
-
Rankings:
- Downloads: 1.566%
- Average: 12.294%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.directconnect
AWS Direct Connect makes it easy to establish a dedicated network connection from your premises to AWS. Using AWS Direct Connect, you can establish private connectivity between AWS and your datacenter, office, or colocation environment, which in many cases can reduce your network costs, increase bandwidth throughput, and provide a more consistent network experience than Internet-based connections.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.5 (published 4 days ago)
- Last Synced: 2026-06-18T13:04:05.239Z (2 days ago)
- Versions: 1,374
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 1,288,970 Total
-
Rankings:
- Downloads: 1.576%
- Average: 12.297%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.medialive
AWS Elemental MediaLive is a video service that lets you easily create live outputs for broadcast and streaming delivery.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.23 (published 10 days ago)
- Last Synced: 2026-06-18T13:03:00.034Z (2 days ago)
- Versions: 1,370
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 989,090 Total
-
Rankings:
- Downloads: 1.578%
- Average: 12.298%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.resourcegroups
AWS Resource Groups lets you search and group AWS resources from multiple services based on their tags.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.3 (published 17 days ago)
- Last Synced: 2026-06-18T19:46:36.856Z (2 days ago)
- Versions: 1,307
- Dependent Packages: 1
- Dependent Repositories: 0
- Downloads: 1,263,617 Total
-
Rankings:
- Downloads: 1.591%
- Average: 12.302%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.pi
Performance Insights is a feature of Amazon Relational Database Service (RDS) that helps you quickly assess the load on your database, and determine when and where to take action. You can use the SDK to retrieve Performance Insights data and integrate your monitoring solutions.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.4 (published 18 days ago)
- Last Synced: 2026-06-15T20:52:13.946Z (5 days ago)
- Versions: 1,303
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 2,016,835 Total
-
Rankings:
- Downloads: 1.617%
- Average: 12.311%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.timestreamwrite
(New Service) Amazon Timestream is a fast, scalable, fully managed, purpose-built time series database that makes it easy to store and analyze trillions of time series data points per day.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.4 (published 11 days ago)
- Last Synced: 2026-06-18T13:06:30.563Z (2 days ago)
- Versions: 1,001
- Dependent Packages: 1
- Dependent Repositories: 0
- Downloads: 2,222,379 Total
-
Rankings:
- Downloads: 1.634%
- Average: 12.317%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.workdocs
Amazon WorkDocs is a fully managed, secure enterprise storage and sharing service with strong administrative controls and feedback capabilities that improve user productivity.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.3 (published 16 days ago)
- Last Synced: 2026-06-18T13:06:51.704Z (2 days ago)
- Versions: 1,331
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 1,119,026 Total
-
Rankings:
- Downloads: 1.661%
- Average: 12.325%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.kinesisanalytics
Amazon Kinesis Analytics is a fully managed service for continuously querying streaming data using standard SQL.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.2 (published 19 days ago)
- Last Synced: 2026-06-18T13:02:22.929Z (2 days ago)
- Versions: 1,336
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 886,914 Total
-
Rankings:
- Downloads: 1.723%
- Average: 12.346%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.personalizeruntime
Amazon Personalize is a machine learning service that makes it easy for developers to create individualized recommendations for customers using their applications.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.2 (published 18 days ago)
- Last Synced: 2026-06-18T13:01:35.999Z (2 days ago)
- Versions: 1,214
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 1,207,321 Total
-
Rankings:
- Downloads: 1.733%
- Average: 12.35%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.greengrass
AWS Greengrass is software that lets you run local compute, messaging, and device state synchronization for connected devices in a secure way. With AWS Greengrass, connected devices can run AWS Lambda functions, keep device data in sync, and communicate with other devices securely even when not connected to the Internet. Using AWS Lambda, Greengrass ensures your IoT devices can respond quickly to local events, operate with intermittent connections, and minimize the cost of transmitting IoT data to the cloud.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.3 (published 19 days ago)
- Last Synced: 2026-06-18T13:01:43.195Z (2 days ago)
- Versions: 1,320
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 823,492 Total
-
Rankings:
- Downloads: 1.769%
- Average: 12.362%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.workmail
Today, Amazon WorkMail released an administrative SDK and enabled AWS CloudTrail integration. With the administrative SDK, you can natively integrate WorkMail with your existing services. The SDK enables programmatic user, resource, and group management through API calls. This means your existing IT tools and workflows can now automate WorkMail management, and third party applications can streamline WorkMail migrations and account actions.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.4 (published 30 days ago)
- Last Synced: 2026-06-18T13:07:40.907Z (2 days ago)
- Versions: 1,315
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 876,397 Total
-
Rankings:
- Downloads: 1.866%
- Average: 12.394%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.route53resolver
This is the first release of the Amazon Route 53 Resolver API. Customers now have the ability to create and manage Amazon Route 53 Resolver endpoints and Amazon Route 53 Resolver rules.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.9 (published 4 days ago)
- Last Synced: 2026-06-18T13:07:15.877Z (2 days ago)
- Versions: 1,280
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 736,330 Total
-
Rankings:
- Downloads: 1.996%
- Average: 12.437%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.iotdeviceadvisor
AWS IoT Core Device Advisor is fully managed test capability for IoT devices. Device manufacturers can use Device Advisor to test their IoT devices for reliable and secure connectivity with AWS IoT.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.3 (published 24 days ago)
- Last Synced: 2026-06-18T13:07:20.851Z (2 days ago)
- Versions: 974
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 651,190 Total
-
Rankings:
- Downloads: 2.144%
- Average: 12.487%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.ioteventsdata
The AWS IoT Events service allows customers to monitor their IoT devices and sensors to detect failures or changes in operation and to trigger actions when these events occur
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.3 (published 19 days ago)
- Last Synced: 2026-06-18T13:07:46.076Z (2 days ago)
- Versions: 1,215
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 612,134 Total
-
Rankings:
- Downloads: 2.202%
- Average: 12.506%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.ebs
This release introduces the EBS direct APIs for Snapshots: 1. ListSnapshotBlocks, which lists the block indexes and block tokens for blocks in an Amazon EBS snapshot. 2. ListChangedBlocks, which lists the block indexes and block tokens for blocks that are different between two snapshots of the same volume/snapshot lineage. 3. GetSnapshotBlock, which returns the data in a block of an Amazon EBS snapshot.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.3 (published 24 days ago)
- Last Synced: 2026-06-18T13:01:36.392Z (2 days ago)
- Versions: 1,141
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 12,924,481 Total
-
Rankings:
- Downloads: 2.21%
- Average: 12.508%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.codeartifact
Added support for AWS CodeArtifact.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.2 (published 30 days ago)
- Last Synced: 2026-06-18T13:01:49.129Z (2 days ago)
- Versions: 1,054
- Dependent Packages: 2
- Dependent Repositories: 0
- Downloads: 775,481 Total
-
Rankings:
- Downloads: 2.242%
- Average: 12.519%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.connectparticipant
This release adds 5 new APIs: CreateParticipantConnection, DisconnectParticipant, GetTranscript, SendEvent, and SendMessage. For Amazon Connect chat, you can use them to programmatically perform participant actions on the configured Amazon Connect instance. Learn more here: https://docs.aws.amazon.com/connect-participant/latest/APIReference/Welcome.html
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.5 (published 16 days ago)
- Last Synced: 2026-06-18T19:31:58.925Z (2 days ago)
- Versions: 1,148
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 660,563 Total
-
Rankings:
- Downloads: 2.259%
- Average: 12.525%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.detective
This is the initial release of Amazon Detective.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.3 (published 23 days ago)
- Last Synced: 2026-06-18T13:03:06.327Z (2 days ago)
- Versions: 1,136
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 591,566 Total
-
Rankings:
- Downloads: 2.332%
- Average: 12.549%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.iotsecuretunneling
This release adds support for IoT Secure Tunneling to remote access devices behind restricted firewalls.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.3 (published 17 days ago)
- Last Synced: 2026-06-18T13:01:48.555Z (2 days ago)
- Versions: 1,141
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 551,014 Total
-
Rankings:
- Downloads: 2.364%
- Average: 12.56%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.workmailmessageflow
This release allows customers to access email messages as they flow to and from Amazon WorkMail.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.3 (published 24 days ago)
- Last Synced: 2026-06-18T19:32:09.345Z (2 days ago)
- Versions: 1,172
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 545,208 Total
-
Rankings:
- Downloads: 2.402%
- Average: 12.572%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.ecrpublic
Supports Amazon Elastic Container Registry (Amazon ECR) Public, a fully managed registry that makes it easy for a developer to publicly share container software worldwide for anyone to download.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.4 (published 24 days ago)
- Last Synced: 2026-06-18T13:01:49.349Z (2 days ago)
- Versions: 977
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 822,943 Total
-
Rankings:
- Downloads: 2.465%
- Average: 12.593%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.networkmanager
This is the initial SDK release for AWS Network Manager.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.5 (published 30 days ago)
- Last Synced: 2026-06-18T13:07:28.660Z (2 days ago)
- Versions: 1,143
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 544,499 Total
-
Rankings:
- Downloads: 2.518%
- Average: 12.611%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.ivs
Introducing Amazon Interactive Video Service - a managed live streaming solution that is quick and easy to set up, and ideal for creating interactive video experiences.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.7 (published 16 days ago)
- Last Synced: 2026-06-18T13:01:40.620Z (2 days ago)
- Versions: 1,044
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 599,567 Total
-
Rankings:
- Downloads: 2.549%
- Average: 12.621%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.kafkaconnect
This is the initial SDK release for Amazon Managed Streaming for Apache Kafka Connect (MSK Connect).
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.6 (published 29 days ago)
- Last Synced: 2026-06-18T19:32:08.581Z (2 days ago)
- Versions: 879
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 563,549 Total
-
Rankings:
- Downloads: 2.926%
- Average: 12.747%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.sagemakerfeaturestoreruntime
This release adds support for Amazon SageMaker Feature Store, which makes it easy for customers to create, version, share, and manage curated data for machine learning (ML) development.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.2 (published 24 days ago)
- Last Synced: 2026-06-18T13:01:54.939Z (2 days ago)
- Versions: 978
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 645,719 Total
-
Rankings:
- Downloads: 3.217%
- Average: 12.844%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.lookoutequipment
This release introduces support for Amazon Lookout for Equipment.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.2 (published 23 days ago)
- Last Synced: 2026-06-18T13:01:57.753Z (2 days ago)
- Versions: 932
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 384,565 Total
-
Rankings:
- Downloads: 3.266%
- Average: 12.86%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.prometheusservice
(New Service) Amazon Managed Service for Prometheus is a fully managed Prometheus-compatible monitoring service that makes it easy to monitor containerized applications securely and at scale.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.9 (published 10 days ago)
- Last Synced: 2026-06-18T13:02:47.915Z (2 days ago)
- Versions: 978
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 380,465 Total
-
Rankings:
- Downloads: 3.388%
- Average: 12.901%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.mgn
Add new service - Application Migration Service.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.10 (published 5 days ago)
- Last Synced: 2026-06-18T13:02:47.585Z (2 days ago)
- Versions: 939
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 381,491 Total
-
Rankings:
- Downloads: 3.487%
- Average: 12.934%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.pinpointsmsvoicev2
Amazon Pinpoint now offers a version 2.0 suite of SMS and voice APIs, providing increased control over sending and configuration. This release is a new SDK for sending SMS and voice messages called PinpointSMSVoiceV2.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.8 (published 23 days ago)
- Last Synced: 2026-06-18T13:07:18.819Z (2 days ago)
- Versions: 806
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 38,261,822 Total
-
Rankings:
- Downloads: 3.667%
- Average: 12.994%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.extensions.bedrock.meai
Implementations of Microsoft.Extensions.AI's abstractions for Bedrock.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.8 (published about 1 month ago)
- Last Synced: 2026-06-18T13:01:39.208Z (2 days ago)
- Versions: 76
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 908,814 Total
-
Rankings:
- Dependent repos count: 7.063%
- Average: 13.006%
- Dependent packages count: 18.949%
- Maintainers (1)
nuget.org: awssdk.drs
Introducing AWS Elastic Disaster Recovery (AWS DRS), a new service that minimizes downtime and data loss with fast, reliable recovery of on-premises and cloud-based applications using affordable storage, minimal compute, and point-in-time recovery.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.5 (published 22 days ago)
- Last Synced: 2026-06-18T13:02:01.253Z (2 days ago)
- Versions: 841
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 760,208 Total
-
Rankings:
- Downloads: 4.187%
- Average: 13.168%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.keyspaces
This release adds support for data definition language (DDL) operations
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.4 (published 23 days ago)
- Last Synced: 2026-06-18T13:07:28.912Z (2 days ago)
- Versions: 811
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 312,424 Total
-
Rankings:
- Downloads: 4.401%
- Average: 13.239%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.backupgateway
Initial release of AWS Backup gateway which enables you to centralize and automate protection of on-premises VMware and VMware Cloud on AWS workloads using AWS Backup.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.4 (published 22 days ago)
- Last Synced: 2026-06-18T13:01:37.948Z (2 days ago)
- Versions: 836
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 318,087 Total
-
Rankings:
- Downloads: 4.493%
- Average: 13.269%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.billingconductor
This is the initial SDK release for AWS Billing Conductor. The AWS Billing Conductor is a customizable billing service, allowing you to customize your billing data to match your desired business structure.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.7 (published 23 days ago)
- Last Synced: 2026-06-18T13:07:07.995Z (2 days ago)
- Versions: 804
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 272,607 Total
-
Rankings:
- Downloads: 4.706%
- Average: 13.34%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.extensions.ec2.decryptpassword
Extensions for the AWS EC2 to get the decrypted password for an EC2 instance.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.0 (published about 1 year ago)
- Last Synced: 2026-06-18T13:07:00.443Z (2 days ago)
- Versions: 63
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 265,062 Total
-
Rankings:
- Dependent repos count: 7.342%
- Average: 13.52%
- Dependent packages count: 19.698%
- Maintainers (1)
nuget.org: awssdk.controltower
This release contains the first SDK for AWS Control Tower. It introduces a new set of APIs: EnableControl, DisableControl, GetControlOperation, and ListEnabledControls.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.5 (published 29 days ago)
- Last Synced: 2026-06-18T19:32:06.899Z (2 days ago)
- Versions: 747
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 239,201 Total
-
Rankings:
- Downloads: 5.809%
- Average: 13.708%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.supportapp
This is the initial SDK release for the AWS Support App in Slack.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.2 (published 24 days ago)
- Last Synced: 2026-06-18T13:01:58.900Z (2 days ago)
- Versions: 744
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 223,645 Total
-
Rankings:
- Downloads: 5.841%
- Average: 13.719%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.migrationhuborchestrator
Introducing AWS MigrationHubOrchestrator. This is the first public release of AWS MigrationHubOrchestrator.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.3 (published 30 days ago)
- Last Synced: 2026-06-18T13:07:53.552Z (2 days ago)
- Versions: 726
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 194,749 Total
-
Rankings:
- Downloads: 6.971%
- Average: 14.095%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.pcaconnectorscep
Connector for SCEP allows you to use a managed, cloud CA to enroll mobile devices and networking gear. SCEP is a widely-adopted protocol used by mobile device management (MDM) solutions for enrolling mobile devices. With the connector, you can use AWS Private CA with popular MDM solutions.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.4 (published 25 days ago)
- Last Synced: 2026-06-18T13:01:34.041Z (2 days ago)
- Versions: 388
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 74,347 Total
-
Rankings:
- Dependent repos count: 7.669%
- Average: 14.12%
- Dependent packages count: 20.571%
- Maintainers (1)
nuget.org: awssdk.omics
Amazon Omics is a new, purpose-built service that can be used by healthcare and life science organizations to store, query, and analyze omics data. The insights from that data can be used to accelerate scientific discoveries and improve healthcare.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.12 (published 9 days ago)
- Last Synced: 2026-06-18T13:07:14.822Z (2 days ago)
- Versions: 702
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 195,536 Total
-
Rankings:
- Downloads: 7.928%
- Average: 14.415%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.odb
This release adds API operations for Oracle Database@AWS. You can use the APIs to create Exadata infrastructure, ODB networks, and Exadata and Autonomous VM clusters inside AWS data centers. The infrastructure is managed by OCI. You can integrate these resources with AWS services.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.8 (published 11 days ago)
- Last Synced: 2026-06-18T13:06:55.009Z (2 days ago)
- Versions: 176
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 57,200 Total
-
Rankings:
- Forks count: 0.734%
- Stargazers count: 1.147%
- Dependent repos count: 6.743%
- Average: 16.678%
- Dependent packages count: 18.091%
- Downloads: 56.673%
- Maintainers (1)
nuget.org: awssdk.geoplaces
Release of Amazon Location Places API. Places enables you to quickly search, display, and filter places, businesses, and locations based on proximity, category, and name
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.5 (published 29 days ago)
- Last Synced: 2026-06-18T13:06:46.993Z (2 days ago)
- Versions: 326
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 244,084 Total
-
Rankings:
- Forks count: 0.51%
- Stargazers count: 0.861%
- Dependent repos count: 7.419%
- Average: 17.231%
- Dependent packages count: 19.905%
- Downloads: 57.459%
- Maintainers (1)
nuget.org: awssdk.rtbfabric
Update for general availability of AWS RTB Fabric service.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.7 (published 24 days ago)
- Last Synced: 2026-06-18T13:01:40.917Z (2 days ago)
- Versions: 111
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 17,786 Total
-
Rankings:
- Forks count: 1.156%
- Dependent repos count: 6.559%
- Stargazers count: 7.835%
- Average: 17.464%
- Dependent packages count: 17.591%
- Downloads: 54.181%
- Maintainers (1)
nuget.org: awssdk.neptunedata
Allows customers to execute data plane actions like bulk loading graphs, issuing graph queries using Gremlin and openCypher directly from the SDK.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.5 (published 29 days ago)
- Last Synced: 2026-06-18T13:05:17.319Z (2 days ago)
- Versions: 532
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 192,896 Total
-
Rankings:
- Dependent repos count: 14.978%
- Average: 17.971%
- Downloads: 18.599%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.bcmrecommendedactions
Initial SDK release for AWS Billing and Cost Management Recommended Actions.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.3 (published 29 days ago)
- Last Synced: 2026-06-18T13:03:21.545Z (2 days ago)
- Versions: 144
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 24,416 Total
-
Rankings:
- Forks count: 1.129%
- Dependent repos count: 6.685%
- Stargazers count: 10.242%
- Dependent packages count: 17.92%
- Average: 18.555%
- Downloads: 56.797%
- Maintainers (1)
nuget.org: awssdk.datazone
Initial release of Amazon DataZone
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.31 (published 5 days ago)
- Last Synced: 2026-06-18T13:07:08.940Z (2 days ago)
- Versions: 538
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 117,080 Total
-
Rankings:
- Dependent repos count: 14.978%
- Average: 19.26%
- Dependent packages count: 20.338%
- Downloads: 22.463%
- Maintainers (1)
nuget.org: awssdk.repostspace
Initial release of AWS re:Post Private
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.3 (published 29 days ago)
- Last Synced: 2026-06-18T13:03:27.952Z (2 days ago)
- Versions: 480
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 99,284 Total
-
Rankings:
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Average: 20.764%
- Downloads: 26.977%
- Maintainers (1)
nuget.org: awssdk.freetier
This is the initial SDK release for the AWS Free Tier GetFreeTierUsage API
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.3 (published 29 days ago)
- Last Synced: 2026-06-18T13:01:11.714Z (2 days ago)
- Versions: 480
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 101,419 Total
-
Rankings:
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Average: 20.766%
- Downloads: 26.982%
- Maintainers (1)
nuget.org: awssdk.b2bi
This is the initial SDK release for AWS B2B Data Interchange.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.5 (published 29 days ago)
- Last Synced: 2026-06-18T13:01:20.421Z (2 days ago)
- Versions: 485
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 107,292 Total
-
Rankings:
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Average: 20.811%
- Downloads: 27.119%
- Maintainers (1)
nuget.org: awssdk.marketplacedeployment
AWS Marketplace Deployment is a new service that provides essential features that facilitate the deployment of software, data, and services procured through AWS Marketplace.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.3 (published 24 days ago)
- Last Synced: 2026-06-18T13:01:54.119Z (2 days ago)
- Versions: 480
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 101,360 Total
-
Rankings:
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Average: 21.124%
- Downloads: 28.056%
- Maintainers (1)
nuget.org: awssdk.cleanroomsml
Public Preview SDK release of AWS Clean Rooms ML APIs
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.11 (published 25 days ago)
- Last Synced: 2026-06-18T13:04:57.723Z (2 days ago)
- Versions: 490
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 102,928 Total
-
Rankings:
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Average: 21.312%
- Downloads: 28.621%
- Maintainers (1)
nuget.org: awssdk.networkmonitor
CloudWatch Network Monitor is a new service within CloudWatch that will help network administrators and operators continuously monitor network performance metrics such as round-trip-time and packet loss between their AWS-hosted applications and their on-premises locations.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.3 (published 23 days ago)
- Last Synced: 2026-06-18T13:03:35.443Z (2 days ago)
- Versions: 466
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 87,079 Total
-
Rankings:
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Average: 22.765%
- Downloads: 32.979%
- Maintainers (1)
nuget.org: awssdk.codeconnections
Duplicating the CodeStar Connections service into the new, rebranded AWS CodeConnections service.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.4 (published 25 days ago)
- Last Synced: 2026-06-18T13:04:17.092Z (2 days ago)
- Versions: 428
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 79,484 Total
-
Rankings:
- Dependent repos count: 7.826%
- Dependent packages count: 9.923%
- Average: 24.943%
- Downloads: 57.078%
- Maintainers (1)
nuget.org: awssdk.controlcatalog
This is the initial SDK release for AWS Control Catalog, a central catalog for AWS managed controls. This release includes 3 new APIs - ListDomains, ListObjectives, and ListCommonControls - that vend high-level data to categorize controls across the AWS platform.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.6 (published 23 days ago)
- Last Synced: 2026-06-18T13:07:05.966Z (2 days ago)
- Versions: 424
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 78,918 Total
-
Rankings:
- Dependent repos count: 7.803%
- Dependent packages count: 9.894%
- Average: 24.943%
- Downloads: 57.133%
- Maintainers (1)
nuget.org: awssdk.sustainability
This is the first release of the AWS Sustainability SDK, which enables customers to access their sustainability impact data via API.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.1 (published 16 days ago)
- Last Synced: 2026-06-18T13:01:38.710Z (2 days ago)
- Versions: 22
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 2,229 Total
-
Rankings:
- Dependent repos count: 6.113%
- Dependent packages count: 16.332%
- Average: 26.231%
- Downloads: 56.247%
- Maintainers (1)
nuget.org: awssdk.s3files
Support for S3 Files, a new shared file system that connects any AWS compute directly with your data in Amazon S3. It provides fast, direct access to all of your S3 data as files with full file system semantics and low-latency performance, without your data ever leaving S3.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.1 (published 16 days ago)
- Last Synced: 2026-06-18T13:06:59.074Z (2 days ago)
- Versions: 18
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 1,644 Total
-
Rankings:
- Dependent repos count: 6.097%
- Dependent packages count: 16.288%
- Average: 26.238%
- Downloads: 56.33%
- Maintainers (1)
nuget.org: awssdk.marketplacediscovery
AWS Marketplace Discovery API provides an interface that enables programmatic access to the AWS Marketplace catalog, including searching and browsing listings, retrieving product details and fulfillment options, and accessing public and private offer pricing and terms.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.1 (published 29 days ago)
- Last Synced: 2026-06-18T13:01:03.959Z (2 days ago)
- Versions: 17
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 1,591 Total
-
Rankings:
- Dependent repos count: 6.095%
- Dependent packages count: 16.282%
- Average: 26.239%
- Downloads: 56.34%
- Maintainers (1)
nuget.org: awssdk.partnercentralaccount
Initial GA launch of Partner Central Account
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.4 (published 29 days ago)
- Last Synced: 2026-06-18T13:07:05.570Z (2 days ago)
- Versions: 85
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 13,442 Total
-
Rankings:
- Dependent repos count: 6.488%
- Dependent packages count: 17.401%
- Average: 26.987%
- Downloads: 57.072%
- Maintainers (1)
nuget.org: awssdk.route53globalresolver
Add SDK for Amazon Route 53 Global Resolver, a fully managed DNS resolver service that offers broad DNS-filtering security controls.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.3 (published 25 days ago)
- Last Synced: 2026-06-18T13:02:03.856Z (2 days ago)
- Versions: 86
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 12,306 Total
-
Rankings:
- Dependent repos count: 6.488%
- Dependent packages count: 17.401%
- Average: 26.987%
- Downloads: 57.072%
- Maintainers (1)
nuget.org: awssdk.novaact
Initial release of Nova Act SDK. The Nova Act service enables customers to build and manage fleets of agents for automating production UI workflows with high reliability, fastest time-to-value, and ease of implementation at scale.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.1 (published 24 days ago)
- Last Synced: 2026-06-18T13:07:14.610Z (2 days ago)
- Versions: 83
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 11,721 Total
-
Rankings:
- Dependent repos count: 6.483%
- Dependent packages count: 17.39%
- Average: 26.988%
- Downloads: 57.091%
- Maintainers (1)
nuget.org: awssdk.keyspacesstreams
This release adds change data capture (CDC) streams support through the new Amazon Keyspaces Streams API.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.5 (published 18 days ago)
- Last Synced: 2026-06-18T13:01:55.981Z (2 days ago)
- Versions: 180
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 32,366 Total
-
Rankings:
- Dependent repos count: 6.75%
- Dependent packages count: 18.11%
- Average: 27.179%
- Downloads: 56.676%
- Maintainers (1)
nuget.org: awssdk.ssmguiconnect
This release adds API support for the connection recording GUI Connect feature of AWS Systems Manager
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.3 (published 22 days ago)
- Last Synced: 2026-06-18T13:01:38.573Z (2 days ago)
- Versions: 214
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 41,098 Total
-
Rankings:
- Dependent repos count: 6.848%
- Dependent packages count: 18.371%
- Average: 27.209%
- Downloads: 56.407%
- Maintainers (1)
nuget.org: awssdk.gameliftstreams
New Service: Amazon GameLift Streams delivers low-latency game streaming from AWS global infrastructure to virtually any device with a browser at up to 1080p resolution and 60 fps.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.7 (published 3 months ago)
- Last Synced: 2026-06-18T13:01:40.266Z (2 days ago)
- Versions: 260
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 51,266 Total
-
Rankings:
- Dependent repos count: 6.952%
- Dependent packages count: 18.65%
- Average: 27.256%
- Downloads: 56.166%
- Maintainers (1)
nuget.org: awssdk.iotmanagedintegrations
Adding managed integrations APIs for IoT Device Management to setup and control devices across different manufacturers and connectivity protocols. APIs include managedthing operations, credential and provisioning profile management, notification configuration, and OTA update.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.8 (published 25 days ago)
- Last Synced: 2026-06-18T13:03:00.751Z (2 days ago)
- Versions: 260
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 51,564 Total
-
Rankings:
- Dependent repos count: 6.953%
- Dependent packages count: 18.654%
- Average: 27.256%
- Downloads: 56.161%
- Maintainers (1)
nuget.org: awssdk.partnercentralselling
Announcing AWS Partner Central API for Selling: This service launch Introduces new APIs for co-selling opportunity management and related functions. Key features include notifications, a dynamic sandbox for testing, and streamlined validations.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.14 (published 3 days ago)
- Last Synced: 2026-06-18T19:46:09.462Z (2 days ago)
- Versions: 328
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 67,635 Total
-
Rankings:
- Dependent repos count: 7.388%
- Dependent packages count: 19.821%
- Average: 27.996%
- Downloads: 56.779%
- Maintainers (1)
nuget.org: awssdk.connectcampaignsv2
Added Amazon Connect Outbound Campaigns V2 SDK.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.9 (published 22 days ago)
- Last Synced: 2026-06-18T13:07:15.895Z (2 days ago)
- Versions: 317
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 64,803 Total
-
Rankings:
- Dependent repos count: 7.388%
- Dependent packages count: 19.821%
- Average: 28.242%
- Downloads: 57.518%
- Maintainers (1)
nuget.org: awssdk.georoutes
Release of Amazon Location Routes API. Routes enables you to plan efficient routes and streamline deliveries by leveraging real-time traffic, vehicle restrictions, and turn-by-turn directions.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.7 (published 17 days ago)
- Last Synced: 2026-06-18T13:07:07.023Z (2 days ago)
- Versions: 324
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 73,714 Total
-
Rankings:
- Dependent repos count: 7.417%
- Dependent packages count: 19.898%
- Average: 28.245%
- Downloads: 57.421%
- Maintainers (1)
nuget.org: awssdk.geomaps
Release of Amazon Location Maps API. Maps enables you to build digital maps that showcase your locations, visualize your data, and unlock insights to drive your business
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.6 (published 16 days ago)
- Last Synced: 2026-06-18T13:02:16.875Z (2 days ago)
- Versions: 328
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 74,888 Total
-
Rankings:
- Dependent repos count: 7.417%
- Dependent packages count: 19.898%
- Average: 28.251%
- Downloads: 57.439%
- Maintainers (1)
nuget.org: awssdk.bedrockdataautomationruntime
Release Bedrock Data Automation Runtime SDK
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.6 (published 23 days ago)
- Last Synced: 2026-06-18T13:02:11.932Z (2 days ago)
- Versions: 309
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 108,950 Total
-
Rankings:
- Dependent repos count: 7.355%
- Dependent packages count: 19.732%
- Average: 28.27%
- Downloads: 57.722%
- Maintainers (1)
nuget.org: awssdk.networkflowmonitor
This release adds documentation for a new feature in Amazon CloudWatch called Network Flow Monitor. You can use Network Flow Monitor to get near real-time metrics, including retransmissions and data transferred, for your actual workloads.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.7 (published 22 days ago)
- Last Synced: 2026-06-18T13:07:05.942Z (2 days ago)
- Versions: 310
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 59,359 Total
-
Rankings:
- Dependent repos count: 7.361%
- Dependent packages count: 19.748%
- Average: 28.272%
- Downloads: 57.707%
- Maintainers (1)
nuget.org: awssdk.s3tables
Amazon S3 Tables deliver the first cloud object store with built-in open table format support, and the easiest way to store tabular data at scale.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.11 (published 25 days ago)
- Last Synced: 2026-06-18T19:46:09.338Z (2 days ago)
- Versions: 315
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 2,984,685 Total
-
Rankings:
- Dependent repos count: 7.358%
- Dependent packages count: 19.738%
- Average: 28.274%
- Downloads: 57.725%
- Maintainers (1)
nuget.org: awssdk.socialmessaging
This release for AWS End User Messaging includes a public SDK, providing a suite of APIs that enable sending WhatsApp messages to end users.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.7 (published 17 days ago)
- Last Synced: 2026-06-18T13:02:27.393Z (2 days ago)
- Versions: 336
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 79,256 Total
-
Rankings:
- Dependent repos count: 7.457%
- Dependent packages count: 20.006%
- Average: 28.315%
- Downloads: 57.481%
- Maintainers (1)
nuget.org: awssdk.marketplacereporting
The AWS Marketplace Reporting service introduces the GetBuyerDashboard API. This API returns a dashboard that provides visibility into your organization's AWS Marketplace agreements and associated spend across the AWS accounts in your organization.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.3 (published 23 days ago)
- Last Synced: 2026-06-18T13:01:39.547Z (2 days ago)
- Versions: 338
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 63,032 Total
-
Rankings:
- Dependent repos count: 7.468%
- Dependent packages count: 20.033%
- Average: 28.326%
- Downloads: 57.476%
- Maintainers (1)
nuget.org: awssdk.applicationsignals
This is the initial SDK release for Amazon CloudWatch Application Signals. Amazon CloudWatch Application Signals provides curated application performance monitoring for developers to monitor and troubleshoot application health using pre-built dashboards and Service Level Objectives.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.9 (published 29 days ago)
- Last Synced: 2026-06-18T13:01:52.554Z (2 days ago)
- Versions: 394
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 75,058 Total
-
Rankings:
- Dependent repos count: 7.672%
- Dependent packages count: 20.579%
- Average: 28.454%
- Downloads: 57.11%
- Maintainers (1)
nuget.org: awssdk.chatbot
This release adds support for AWS Chatbot. You can now monitor, operate, and troubleshoot your AWS resources with interactive ChatOps using the AWS SDK.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.2 (published 23 days ago)
- Last Synced: 2026-06-18T13:06:54.490Z (2 days ago)
- Versions: 440
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 194,089 Total
-
Rankings:
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Average: 30.709%
- Downloads: 56.81%
- Maintainers (1)