https://github.com/aws/aws-sdk-net
Score: 32.56862434037928
Last synced: about 3 hours ago
JSON representation
Repository metadata:
The official AWS SDK for .NET. For more information on the AWS SDK for .NET, see our web site:
- Host: GitHub
- URL: https://github.com/aws/aws-sdk-net
- Owner: aws
- License: apache-2.0
- Created: 2012-01-23T23:50:43.000Z (over 14 years ago)
- Default Branch: main
- Last Pushed: 2026-08-20T20:24:06.000Z (3 days ago)
- Last Synced: 2026-08-20T23:56:25.394Z (3 days ago)
- Language: C#
- Homepage: https://aws.amazon.com/sdk-for-net/
- Size: 2.01 GB
- Stars: 133
- Watchers: 7
- Forks: 890
- Open Issues: 34
-
Metadata Files:
- Readme: README.md
- Changelog: changelogs/SDK.CHANGELOG.2015.md
- Contributing: CONTRIBUTING.md
- License: License.txt
- Codeowners: .github/CODEOWNERS
- Notice: Notice.txt
- Copilot: .github/copilot-instructions.md
Owner metadata:
- Name: Amazon Web Services
- Login: aws
- Email: open-source-github@amazon.com
- Kind: organization
- Description:
- Website: https://amazon.com/aws
- Location: United States of America
- Twitter:
- Company:
- Icon url: https://avatars.githubusercontent.com/u/2232217?v=4
- Repositories: 553
- Last Synced at: 2026-08-21T23:27:01.076Z
- Profile URL: https://github.com/aws
GitHub Events
Total
- Commit comment event: 6
- Create event: 753
- Delete event: 468
- Discussion event: 1
- Fork event: 36
- Issue comment event: 1122
- Issues event: 328
- Member event: 1
- Pull request event: 634
- Pull request review comment event: 1440
- Pull request review event: 1717
- Push event: 2268
- Release event: 289
- Watch event: 164
- Total: 9227
Last Year
- Create event: 228
- Delete event: 199
- Discussion event: 1
- Fork event: 7
- Issue comment event: 202
- Issues event: 116
- Pull request event: 159
- Pull request review comment event: 538
- Pull request review event: 532
- Push event: 984
- Release event: 78
- Watch event: 32
- Total: 3076
Committers metadata
Last synced: 28 days ago
Total Commits: 0
Total Committers: 184
Avg Commits per committer: 84.864
Development Distribution Score (DDS): 0.353
Commits in past year: 2,282
Committers in past year: 29
Avg Commits per committer in past year: 78.69
Development Distribution Score (DDS) in past year: 0.171
| Name | Commits | |
|---|---|---|
| aws-sdk-dotnet-automation | g****n@a****m | 10105 |
| Steven Kang | s****g@a****m | 1467 |
| Norm Johanson | n****j@a****m | 1218 |
| Steve Roberts | s****e@a****m | 372 |
| Pavel Safronov | p****l@a****m | 266 |
| Daniel Pinheiro | d****n@a****m | 176 |
| Vellozzi | v****i@a****m | 169 |
| Milind Gokarn | g****m@a****m | 158 |
| Karthik Saligrama | s****m@a****m | 154 |
| Sattwik Pati | s****p@a****m | 127 |
| Bo Blodgett | b****d@a****m | 126 |
| Peter Song | p****g@a****m | 106 |
| Muhammad Othman | m****n@g****m | 101 |
| Johnny Hoffman | j****f@a****m | 76 |
| amazonwebservices | a****s@a****m | 76 |
| Alex Shovlin | s****a@a****m | 75 |
| ashdhin | a****n@a****m | 69 |
| Aaron Costley | c****a@a****m | 56 |
| Jim Flanagan | j****l@a****m | 55 |
| philip pittle | p****e@a****m | 39 |
| Weijia Mao | m****j@a****m | 33 |
| Sergey Klementiev | k****i@a****m | 32 |
| Matteo Prosperi | 4****i | 32 |
| Malhar Khimsaria | k****r@a****m | 27 |
| danielmarbach | d****h@o****t | 24 |
| Phil Asmar | p****r@g****m | 24 |
| Norm Johanson | N****n | 24 |
| Sruti Guhathakurta | s****a@g****m | 23 |
| Tyler Moore | t****e@a****m | 18 |
| Ganesh Jangir | j****g@a****m | 14 |
| and 154 more... | ||
Issue and Pull Request metadata
Last synced: about 4 hours ago
Total issues: 599
Total pull requests: 1,315
Average time to close issues: 11 months
Average time to close pull requests: 15 days
Total issue authors: 507
Total pull request authors: 91
Average comments per issue: 5.35
Average comments per pull request: 0.91
Merged pull request: 924
Bot issues: 0
Bot pull requests: 25
Past year issues: 68
Past year pull requests: 287
Past year average time to close issues: about 1 month
Past year average time to close pull requests: 9 days
Past year issue authors: 62
Past year pull request authors: 30
Past year average comments per issue: 3.63
Past year average comments per pull request: 0.94
Past year merged pull request: 178
Past year bot issues: 0
Past year bot pull requests: 1
Top Issue Authors
- martincostello (8)
- lyndaidaii (7)
- normj (6)
- paulomorgado (6)
- danielmarbach (6)
- dscpinheiro (5)
- lonix1 (4)
- Dreamescaper (4)
- genifycom (4)
- grsw92 (4)
- rittneje (4)
- SonalCalcey (3)
- Mr0N (3)
- teo-tsirpanis (3)
- alex-jitbit (3)
Top Pull Request Authors
- peterrsongg (249)
- dscpinheiro (160)
- muhammad-othman (137)
- normj (135)
- boblodgett (93)
- GarrettBeatty (66)
- ashishdhingra (62)
- AlexDaines (35)
- ashovlin (34)
- 96malhar (30)
- irina-herciu (30)
- danielmarbach (26)
- dependabot[bot] (25)
- stephentoub (20)
- philasmar (20)
Top Issue Labels
- bug (387)
- queued (185)
- p2 (174)
- feature-request (139)
- response-requested (134)
- s3 (108)
- module/sdk-core (79)
- closed-for-staleness (77)
- p1 (75)
- dynamodb (74)
- needs-triage (73)
- module/sdk-generated (58)
- credentials (41)
- p3 (36)
- potential-regression (33)
- needs-review (33)
- v4 (28)
- guidance (27)
- needs-reproduction (27)
- module/sdk-custom (26)
- documentation (26)
- pending-release (18)
- service-api (15)
- closing-soon (14)
- Extensions (12)
- investigating (12)
- cross-sdk-parity (10)
- perf (10)
- needs-investigation (10)
- module/unity (10)
Top Pull Request Labels
- v4 (339)
- SRA (33)
- dependencies (25)
- perf (23)
- v3 (18)
- bug (13)
- p2 (12)
- queued (12)
- dynamodb (6)
- feature-request (6)
- pr/needs-review (4)
- response-requested (3)
- s3 (3)
- p1 (3)
- aot (2)
- module/sdk-custom (2)
- module/sdk-core (2)
- cross-sdk (2)
- low-effort (1)
- doc-apireference (1)
- pr/blocked (1)
- .NET (1)
- needs-major-version (1)
- credentials (1)
Package metadata
- Total packages: 100
-
Total downloads:
- nuget: 4,537,737,238 total
- Total dependent packages: 2,046 (may contain duplicates)
- Total dependent repositories: 0 (may contain duplicates)
- Total versions: 95,916
- Total maintainers: 2
nuget.org: mapsuitedependency-awssdks3
"Amazon Simple Storage Service (Amazon S3), provides developers and IT teams with secure, durable, highly-scalable object storage." ** This is a repackage of the third party Amazon S3 project for use with ThinkGeo's Map Suite product line. ** ** You should not need to reference this package directly, it will be a dependency of other Map Suite packages. ** The purpose of the repackage is to enable ThinkGeo to control release and debug versions known to be compatible with various Map Suite products and to provide ongoing backward compatibility independent from the original author. You can find more information at the link below. Why we repackage: http://wiki.thinkgeo.com/wiki/repackagednugetpackages Supported Platforms: Windows Source Website: https://aws.amazon.com/s3/
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: apache-2.0
- Latest release: (published 1 day ago)
- Last Synced: 2026-08-22T21:02:52.506Z (1 day ago)
- Versions: 1
- Dependent Packages: 1
- Dependent Repositories: 0
-
Rankings:
- Forks count: 0.315%
- Stargazers count: 0.605%
- Average: 5.987%
- Dependent packages count: 10.33%
- Dependent repos count: 12.697%
nuget.org: awssdk.core
The Amazon Web Services SDK for .NET - Core Runtime
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.102 (published 3 days ago)
- Last Synced: 2026-08-23T09:08:59.568Z (about 16 hours ago)
- Versions: 1,499
- Dependent Packages: 670
- Dependent Repositories: 0
- Downloads: 1,977,711,800 Total
-
Rankings:
- Downloads: 0.024%
- Forks count: 0.669%
- Stargazers count: 0.798%
- Average: 7.361%
- Dependent repos count: 14.976%
- Dependent packages count: 20.335%
- Maintainers (1)
nuget.org: awssdk.s3
Amazon Simple Storage Service (Amazon S3), provides developers and IT teams with secure, durable, highly-scalable object storage.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.102 (published 17 days ago)
- Last Synced: 2026-08-22T06:24:07.761Z (2 days ago)
- Versions: 1,558
- Dependent Packages: 540
- Dependent Repositories: 0
- Downloads: 639,015,668 Total
-
Rankings:
- Downloads: 0.051%
- Forks count: 0.669%
- Stargazers count: 0.798%
- Average: 7.366%
- Dependent repos count: 14.976%
- Dependent packages count: 20.335%
- Maintainers (1)
nuget.org: awssdk.extensions.netcore.setup
Extensions for the AWS SDK for .NET to integrate with .NET Core configuration and dependency injection frameworks.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.101 (published 3 days ago)
- Last Synced: 2026-08-23T17:30:44.124Z (about 7 hours ago)
- Versions: 109
- Dependent Packages: 111
- Dependent Repositories: 0
- Downloads: 278,475,673 Total
-
Rankings:
- Downloads: 0.099%
- Average: 10.918%
- Dependent repos count: 13.819%
- Dependent packages count: 18.835%
- Maintainers (1)
nuget.org: awssdk.interconnect
Initial release of AWS Interconnect -- a managed private connectivity service that enables you to create high-speed network connections between your AWS Virtual Private Clouds (VPCs) and your VPCs on other public clouds or your on-premise networks.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.100 (published about 2 months ago)
- Last Synced: 2026-08-22T21:01:12.135Z (1 day ago)
- Versions: 30
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 3,982 Total
-
Rankings:
- Dependent repos count: 6.083%
- Average: 11.166%
- Dependent packages count: 16.249%
- Maintainers (1)
nuget.org: awssdk.sqs
Amazon Simple Queue Service (SQS) is a fast, reliable, scalable, fully managed message queuing service. SQS makes it simple and cost-effective to decouple the components of a cloud application.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.100 (published about 2 months ago)
- Last Synced: 2026-08-22T21:02:20.357Z (1 day ago)
- Versions: 1,394
- Dependent Packages: 212
- Dependent Repositories: 0
- Downloads: 335,043,009 Total
-
Rankings:
- Downloads: 0.092%
- Average: 11.802%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.dynamodbv2
Amazon DynamoDB is a fast and flexible NoSQL database service for all applications that need consistent, single-digit millisecond latency at any scale.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.103 (published 19 days ago)
- Last Synced: 2026-08-22T21:02:43.438Z (1 day ago)
- Versions: 1,463
- Dependent Packages: 185
- Dependent Repositories: 0
- Downloads: 256,699,381 Total
-
Rankings:
- Downloads: 0.107%
- Average: 11.808%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.simplenotificationservice
Amazon Simple Notification Service (Amazon SNS) is a fast, flexible, fully managed push messaging service. Amazon SNS makes it simple and cost-effective to push notifications to Apple, Google, Fire OS, and Windows devices, as well as Android devices in China with Baidu Cloud Push. You can also use SNS to push notifications to internet connected smart devices, as well as other distributed services.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.100 (published about 2 months ago)
- Last Synced: 2026-08-23T20:30:45.137Z (about 4 hours ago)
- Versions: 1,385
- Dependent Packages: 108
- Dependent Repositories: 0
- Downloads: 223,276,865 Total
-
Rankings:
- Downloads: 0.116%
- Average: 11.81%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.secretsmanager
AWS Secrets Manager enables you to easily create and manage the secrets that you use in your customer-facing apps. Instead of embedding credentials into your source code, you can dynamically query Secrets Manager from your app whenever you need credentials. You can automatically and frequently rotate your secrets without having to deploy updates to your apps. All secret values are encrypted when they're at rest with AWS KMS, and while they're in transit with HTTPS and TLS.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.100 (published about 2 months ago)
- Last Synced: 2026-08-22T21:03:10.867Z (1 day ago)
- Versions: 1,337
- Dependent Packages: 89
- Dependent Repositories: 0
- Downloads: 249,303,086 Total
-
Rankings:
- Downloads: 0.125%
- Average: 11.814%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.cloudwatch
Amazon CloudWatch is a monitoring service for AWS cloud resources and the applications you run on AWS. You can use Amazon CloudWatch to collect and track metrics, collect and monitor log files, and set alarms.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.104 (published 2 days ago)
- Last Synced: 2026-08-22T21:03:43.565Z (1 day ago)
- Versions: 1,408
- Dependent Packages: 18
- Dependent Repositories: 0
- Downloads: 68,781,638 Total
-
Rankings:
- Downloads: 0.225%
- Average: 11.847%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.cognitoidentityprovider
You can create a user pool in Amazon Cognito Identity to manage directories and users. You can authenticate a user to obtain tokens related to user identity and access policies. This API reference provides information about user pools in Amazon Cognito Identity, which is a new capability that is available as a beta.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.103 (published about 1 month ago)
- Last Synced: 2026-08-23T00:31:19.321Z (1 day ago)
- Versions: 1,398
- Dependent Packages: 39
- Dependent Repositories: 0
- Downloads: 60,050,150 Total
-
Rankings:
- Downloads: 0.231%
- Average: 11.849%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.identitymanagement
AWS Identity and Access Management (IAM) enables you to securely control access to AWS services and resources for your users. Using IAM, you can create and manage AWS users and groups, and use permissions to allow and deny their access to AWS resources.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.103 (published 11 days ago)
- Last Synced: 2026-08-22T21:02:22.470Z (1 day ago)
- Versions: 1,411
- Dependent Packages: 7
- Dependent Repositories: 0
- Downloads: 40,039,699 Total
-
Rankings:
- Downloads: 0.268%
- Average: 11.861%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.cloudfront
Amazon CloudFront is a content delivery web service. It integrates with other Amazon Web Services products to give developers and businesses an easy way to distribute content to end users with low latency, high data transfer speeds, and no minimum usage commitments.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.101 (published 3 days ago)
- Last Synced: 2026-08-22T21:02:09.826Z (1 day ago)
- Versions: 1,426
- Dependent Packages: 5
- Dependent Repositories: 0
- Downloads: 44,268,644 Total
-
Rankings:
- Downloads: 0.319%
- Average: 11.878%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.eventbridge
Amazon EventBridge is a serverless event bus service that makes it easy to connect your applications with data from a variety of sources, including AWS services, partner applications, and your own applications.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.100 (published about 2 months ago)
- Last Synced: 2026-08-23T17:31:02.984Z (about 7 hours ago)
- Versions: 1,220
- Dependent Packages: 9
- Dependent Repositories: 0
- Downloads: 42,606,080 Total
-
Rankings:
- Downloads: 0.391%
- Average: 11.902%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.appconfigdata
AWS AppConfig Data is a new service that allows you to retrieve configuration deployed by AWS AppConfig. See the AppConfig user guide for more details on getting started. https://docs.aws.amazon.com/appconfig/latest/userguide/what-is-appconfig.html
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.100 (published about 2 months ago)
- Last Synced: 2026-08-22T21:02:29.976Z (1 day ago)
- Versions: 855
- Dependent Packages: 6
- Dependent Repositories: 0
- Downloads: 51,464,909 Total
-
Rankings:
- Downloads: 0.402%
- Average: 11.906%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.apigateway
Amazon API Gateway helps developers deliver robust, secure and scalable mobile and web application backends. Amazon API Gateway allows developers to securely connect mobile and web applications to APIs that run on AWS Lambda, Amazon EC2, or other publicly addressable web services that are hosted outside of AWS.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.100 (published about 2 months ago)
- Last Synced: 2026-08-22T21:02:30.075Z (1 day ago)
- Versions: 1,405
- Dependent Packages: 6
- Dependent Repositories: 0
- Downloads: 21,280,940 Total
-
Rankings:
- Downloads: 0.403%
- Average: 11.906%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.route53
Amazon Route 53 is a highly available and scalable cloud Domain Name System (DNS) web service.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.100 (published about 2 months ago)
- Last Synced: 2026-08-22T21:01:36.201Z (1 day ago)
- Versions: 1,412
- Dependent Packages: 10
- Dependent Repositories: 0
- Downloads: 20,974,316 Total
-
Rankings:
- Downloads: 0.407%
- Average: 11.907%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.cloudwatchevents
Amazon CloudWatch Events helps you to respond to state changes in your AWS resources. When your resources change state they automatically send events into an event stream. You can create rules that match selected events in the stream and route them to targets to take action. You can also use rules to take action on a pre-determined schedule.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.100 (published about 2 months ago)
- Last Synced: 2026-08-22T21:03:22.204Z (1 day ago)
- Versions: 1,370
- Dependent Packages: 5
- Dependent Repositories: 0
- Downloads: 23,803,028 Total
-
Rankings:
- Downloads: 0.434%
- Average: 11.917%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.applicationautoscaling
Application Auto Scaling is a general purpose Auto Scaling service for supported elastic AWS resources. With Application Auto Scaling, you can automatically scale your AWS resources, with an experience similar to that of Amazon EC2 Auto Scaling.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.100 (published about 2 months ago)
- Last Synced: 2026-08-22T21:02:35.284Z (1 day ago)
- Versions: 1,381
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 10,529,503 Total
-
Rankings:
- Downloads: 0.472%
- Average: 11.929%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.elasticloadbalancing
Elastic Load Balancing automatically distributes incoming application traffic across multiple compute instances in the cloud.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.100 (published about 2 months ago)
- Last Synced: 2026-08-22T21:02:47.377Z (1 day ago)
- Versions: 1,371
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 9,632,586 Total
-
Rankings:
- Downloads: 0.474%
- Average: 11.93%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.translate
Public preview release of Amazon Translate and the Amazon Translate Developer Guide. For more information, see the Amazon Translate Developer Guide.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.100 (published about 2 months ago)
- Last Synced: 2026-08-22T21:02:34.271Z (1 day ago)
- Versions: 1,323
- Dependent Packages: 5
- Dependent Repositories: 0
- Downloads: 10,379,528 Total
-
Rankings:
- Downloads: 0.481%
- Average: 11.932%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.redshift
Amazon Redshift is a fast, fully managed, petabyte-scale data warehouse solution that makes it simple and cost-effective to efficiently analyze all your data using your existing business intelligence tools.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.102 (published 4 days ago)
- Last Synced: 2026-08-22T21:02:00.502Z (1 day ago)
- Versions: 1,403
- Dependent Packages: 2
- Dependent Repositories: 0
- Downloads: 9,255,921 Total
-
Rankings:
- Downloads: 0.488%
- Average: 11.935%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.elasticfilesystem
Amazon Elastic File System (Amazon EFS) is a file storage service for Amazon Elastic Compute Cloud (Amazon EC2) instances.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.100 (published about 2 months ago)
- Last Synced: 2026-08-22T21:03:24.314Z (1 day ago)
- Versions: 1,380
- Dependent Packages: 2
- Dependent Repositories: 0
- Downloads: 8,212,920 Total
-
Rankings:
- Downloads: 0.502%
- Average: 11.939%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.transfer
AWS Transfer for SFTP is a fully managed service that enables transfer of secure data over the internet into and out of Amazon S3. SFTP is deeply embedded in data exchange workflows across different industries such as financial services, healthcare, advertising, and retail, among others.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.100 (published about 2 months ago)
- Last Synced: 2026-08-22T21:02:58.287Z (1 day ago)
- Versions: 1,310
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 23,534,562 Total
-
Rankings:
- Downloads: 0.505%
- Average: 11.94%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.wafv2
This release introduces new set of APIs (wafv2) for AWS WAF. Major changes include single set of APIs for creating/updating resources in global and regional scope, and rules are configured directly into web ACL instead of being referenced. The previous APIs (waf and waf-regional) are now referred as AWS WAF Classic. For more information visit: https://docs.aws.amazon.com/waf/latest/APIReference/Welcome.html
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.101 (published 25 days ago)
- Last Synced: 2026-08-22T21:01:40.204Z (1 day ago)
- Versions: 1,177
- Dependent Packages: 2
- Dependent Repositories: 0
- Downloads: 8,891,834 Total
-
Rankings:
- Downloads: 0.509%
- Average: 11.942%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.elasticsearch
Use the Amazon Elasticsearch configuration API to create, configure, and manage Elasticsearch domains.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.101 (published about 1 month ago)
- Last Synced: 2026-08-22T21:03:34.856Z (1 day ago)
- Versions: 1,383
- Dependent Packages: 2
- Dependent Repositories: 0
- Downloads: 7,490,192 Total
-
Rankings:
- Downloads: 0.511%
- Average: 11.942%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.marketplaceentitlementservice
AWS Marketplace Entitlement Service enables AWS Marketplace sellers to determine the capacity purchased by their customers.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.100 (published about 2 months ago)
- Last Synced: 2026-08-22T21:03:21.263Z (1 day ago)
- Versions: 1,329
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 7,261,884 Total
-
Rankings:
- Downloads: 0.516%
- Average: 11.944%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.transcribeservice
Amazon Transcribe Public Preview Release
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.100 (published about 2 months ago)
- Last Synced: 2026-08-22T21:02:10.614Z (1 day ago)
- Versions: 1,341
- Dependent Packages: 3
- Dependent Repositories: 0
- Downloads: 9,468,189 Total
-
Rankings:
- Downloads: 0.517%
- Average: 11.944%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.inspector
Amazon Inspector identifies security issues in your application deployments.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.100 (published about 2 months ago)
- Last Synced: 2026-08-22T21:03:06.494Z (1 day ago)
- Versions: 1,374
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 7,070,232 Total
-
Rankings:
- Downloads: 0.52%
- Average: 11.945%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.securityhub
AWS Security Hub provides you with a comprehensive view of your security state within AWS and your compliance with the security industry standards and best practices. Security Hub collects security data from across AWS accounts, services, and supported third-party partners and helps you analyze your security trends and identify the highest priority security issues.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.103 (published 17 days ago)
- Last Synced: 2026-08-22T21:03:00.670Z (1 day ago)
- Versions: 1,322
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 7,314,448 Total
-
Rankings:
- Downloads: 0.538%
- Average: 11.951%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.networkfirewall
(New Service) AWS Network Firewall is a managed network layer firewall service that makes it easy to secure your virtual private cloud (VPC) networks and block malicious traffic.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.104 (published 20 days ago)
- Last Synced: 2026-08-22T21:03:34.840Z (1 day ago)
- Versions: 1,020
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 5,957,851 Total
-
Rankings:
- Downloads: 0.6%
- Average: 11.972%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.account
This release of the Account Management API enables customers to manage the alternate contacts for their AWS accounts. For more information, see https://docs.aws.amazon.com/accounts/latest/reference/accounts-welcome.html
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.101 (published 27 days ago)
- Last Synced: 2026-08-22T21:03:43.124Z (1 day ago)
- Versions: 886
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 5,040,595 Total
-
Rankings:
- Downloads: 0.659%
- Average: 11.991%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.pinpoint
Amazon Pinpoint makes it easy to run targeted campaigns to improve user engagement. Pinpoint helps you understand your users behavior, define who to target, what messages to send, when to deliver them, and tracks the results of the campaign.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.100 (published about 2 months ago)
- Last Synced: 2026-08-22T21:03:35.412Z (1 day ago)
- Versions: 1,358
- Dependent Packages: 1
- Dependent Repositories: 0
- Downloads: 7,341,129 Total
-
Rankings:
- Downloads: 0.793%
- Average: 12.036%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.codedeploy
AWS CodeDeploy is a service that automates code deployments. AWS CodeDeploy makes it easier for you to rapidly release new features, helps you avoid downtime during deployment, and handles the complexity of updating your applications.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.100 (published about 2 months ago)
- Last Synced: 2026-08-22T21:03:05.264Z (1 day ago)
- Versions: 1,389
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 4,434,644 Total
-
Rankings:
- Downloads: 0.922%
- Average: 12.079%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.simpledb
Amazon SimpleDB is a highly available, scalable, and flexible non-relational data store that enables you to store and query data items using web services requests.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.100 (published about 2 months ago)
- Last Synced: 2026-08-22T21:03:35.403Z (1 day ago)
- Versions: 1,363
- Dependent Packages: 1
- Dependent Repositories: 0
- Downloads: 3,264,345 Total
-
Rankings:
- Downloads: 0.972%
- Average: 12.096%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.codecommit
AWS CodeCommit is a fully-managed source control service that makes it easy for companies to host secure and highly scalable private Git repositories.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.101 (published 10 days ago)
- Last Synced: 2026-08-22T21:03:36.605Z (1 day ago)
- Versions: 1,375
- Dependent Packages: 6
- Dependent Repositories: 0
- Downloads: 3,896,979 Total
-
Rankings:
- Downloads: 0.975%
- Average: 12.097%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.cloudsearch
Amazon CloudSearch is a managed service in the AWS Cloud that makes it simple and cost-effective to set up, manage, and scale a search solution for your website or application.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.100 (published about 2 months ago)
- Last Synced: 2026-08-22T21:02:09.015Z (1 day ago)
- Versions: 1,367
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 2,593,908 Total
-
Rankings:
- Downloads: 1.008%
- Average: 12.108%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.quicksight
Amazon QuickSight is a fully managed, serverless, cloud business intelligence system that allows you to extend data and insights to every user in your organization. The first release of APIs for Amazon QuickSight introduces embedding and user/group management capabilities. The get-dashboard-embed-url API allows you to obtain an authenticated dashboard URL that can be embedded in application domains whitelisted for QuickSight dashboard embedding. User APIs allow you to programmatically expand and manage your QuickSight deployments while group APIs allow easier permissions management for resources within QuickSight.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.107 (published 11 days ago)
- Last Synced: 2026-08-22T21:02:46.026Z (1 day ago)
- Versions: 1,337
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 3,721,113 Total
-
Rankings:
- Downloads: 1.128%
- Average: 12.148%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.alexaforbusiness
Alexa for Business is now generally available for production use. Alexa for Business makes it easy for you to use Alexa in your organization. The Alexa for Business SDK gives you APIs to manage Alexa devices, enroll users, and assign skills at scale. For more information about Alexa for Business, go to https://aws.amazon.com/alexaforbusiness
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 3.7.300 (published almost 3 years ago)
- Last Synced: 2026-08-22T21:02:59.108Z (1 day ago)
- Versions: 919
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 1,439,431 Total
-
Rankings:
- Downloads: 1.234%
- Average: 12.183%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.gamelift
Amazon GameLift Service is a managed AWS service for developers who need a scalable, server-based solution for multiplayer games.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.102 (published 17 days ago)
- Last Synced: 2026-08-22T21:03:36.159Z (1 day ago)
- Versions: 1,395
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 1,590,448 Total
-
Rankings:
- Downloads: 1.297%
- Average: 12.204%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.sagemakerruntime
Amazon SageMaker is a fully-managed service that enables data scientists and developers to quickly and easily build, train, and deploy machine learning models, at scale.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.101 (published 13 days ago)
- Last Synced: 2026-08-22T20:33:11.355Z (1 day ago)
- Versions: 1,322
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 4,588,595 Total
-
Rankings:
- Downloads: 1.322%
- Average: 12.212%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.awssupport
The AWS Support API provides methods for creating and managing AWS Support cases and for retrieving the results of AWS Trusted Advisor checks.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.100 (published about 2 months ago)
- Last Synced: 2026-08-22T21:03:43.019Z (1 day ago)
- Versions: 1,368
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 1,491,061 Total
-
Rankings:
- Downloads: 1.327%
- Average: 12.214%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: lingfennan.awssdk.core
The Amazon Web Services SDK for .NET - Core Runtime
- Homepage: https://github.com/aws/aws-sdk-net/
- Status: removed
- Licenses: apache-2.0
- Latest release: (published 1 day ago)
- Last Synced: 2026-08-22T21:02:39.132Z (1 day ago)
- Versions: 1
- Dependent Packages: 0
- Dependent Repositories: 0
-
Rankings:
- Dependent repos count: 10.162%
- Average: 12.258%
- Downloads: 12.728%
- Dependent packages count: 13.886%
- Maintainers (1)
nuget.org: awssdk.datapipeline
AWS Data Pipeline is a managed extract-transform-load (ETL) service that helps you reliably and cost-effectively move and process data across your on-premise data stores and AWS services.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.100 (published about 2 months ago)
- Last Synced: 2026-08-22T21:03:13.294Z (1 day ago)
- Versions: 1,367
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 1,262,992 Total
-
Rankings:
- Downloads: 1.484%
- Average: 12.266%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.connect
Amazon Connect is a self-service, cloud-based contact center service that makes it easy for any business to deliver better customer service at lower cost.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.111 (published 6 days ago)
- Last Synced: 2026-08-22T21:03:25.536Z (1 day ago)
- Versions: 1,415
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 3,058,931 Total
-
Rankings:
- Downloads: 1.484%
- Average: 12.267%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.cloud9
Adds support for creating and managing AWS Cloud9 development environments. AWS Cloud9 is a cloud-based integrated development environment (IDE) that you use to write, run, and debug code.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.100 (published about 2 months ago)
- Last Synced: 2026-08-22T21:03:09.580Z (1 day ago)
- Versions: 1,329
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 1,038,386 Total
-
Rankings:
- Downloads: 1.507%
- Average: 12.274%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.medialive
AWS Elemental MediaLive is a video service that lets you easily create live outputs for broadcast and streaming delivery.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.103 (published 4 days ago)
- Last Synced: 2026-08-22T21:03:10.916Z (1 day ago)
- Versions: 1,385
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 1,019,679 Total
-
Rankings:
- Downloads: 1.578%
- Average: 12.298%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.pi
Performance Insights is a feature of Amazon Relational Database Service (RDS) that helps you quickly assess the load on your database, and determine when and where to take action. You can use the SDK to retrieve Performance Insights data and integrate your monitoring solutions.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.100 (published about 2 months ago)
- Last Synced: 2026-08-22T21:02:27.913Z (1 day ago)
- Versions: 1,317
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 2,101,466 Total
-
Rankings:
- Downloads: 1.617%
- Average: 12.311%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.snowball
Amazon Snowball is a petabyte-scale data transport solution that uses secure appliances to transfer large amounts of data into and out of the AWS cloud
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.100 (published about 2 months ago)
- Last Synced: 2026-08-22T21:03:06.046Z (1 day ago)
- Versions: 1,353
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 925,113 Total
-
Rankings:
- Downloads: 1.665%
- Average: 12.327%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.lexmodelbuildingservice
Amazon Lex is a service for building conversational interfaces into any application using voice and text.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.100 (published about 2 months ago)
- Last Synced: 2026-08-22T21:01:32.846Z (1 day ago)
- Versions: 1,343
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 992,805 Total
-
Rankings:
- Downloads: 1.676%
- Average: 12.331%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.personalizeruntime
Amazon Personalize is a machine learning service that makes it easy for developers to create individualized recommendations for customers using their applications.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.100 (published about 2 months ago)
- Last Synced: 2026-08-22T21:03:44.535Z (1 day ago)
- Versions: 1,227
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 1,245,029 Total
-
Rankings:
- Downloads: 1.733%
- Average: 12.35%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.kinesisvideoarchivedmedia
Announcing Amazon Kinesis Video Streams, a fully managed video ingestion and storage service. Kinesis Video Streams makes it easy to securely stream video from connected devices to AWS for machine learning, analytics, and processing. You can also stream other time-encoded data like RADAR and LIDAR signals using Kinesis Video Streams.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.100 (published about 2 months ago)
- Last Synced: 2026-08-22T21:01:47.487Z (1 day ago)
- Versions: 1,321
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 904,041 Total
-
Rankings:
- Downloads: 1.734%
- Average: 12.35%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.pinpointsmsvoice
With Amazon Pinpoint Voice, you can use text-to-speech technology to deliver personalized voice messages to your customers. Amazon Pinpoint Voice is a way to deliver transactional messages -- such as one-time passwords and appointment confirmations to customers.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.100 (published about 2 months ago)
- Last Synced: 2026-08-22T21:02:28.396Z (1 day ago)
- Versions: 1,283
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 1,013,906 Total
-
Rankings:
- Downloads: 1.794%
- Average: 12.37%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.workmail
Today, Amazon WorkMail released an administrative SDK and enabled AWS CloudTrail integration. With the administrative SDK, you can natively integrate WorkMail with your existing services. The SDK enables programmatic user, resource, and group management through API calls. This means your existing IT tools and workflows can now automate WorkMail management, and third party applications can streamline WorkMail migrations and account actions.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.100 (published about 2 months ago)
- Last Synced: 2026-08-22T21:02:28.730Z (1 day ago)
- Versions: 1,328
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 895,990 Total
-
Rankings:
- Downloads: 1.866%
- Average: 12.394%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.timestreamquery
(New Service) Amazon Timestream is a fast, scalable, fully managed, purpose-built time series database that makes it easy to store and analyze trillions of time series data points per day.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.100 (published about 2 months ago)
- Last Synced: 2026-08-22T21:01:45.914Z (1 day ago)
- Versions: 1,013
- Dependent Packages: 1
- Dependent Repositories: 0
- Downloads: 1,784,573 Total
-
Rankings:
- Downloads: 1.872%
- Average: 12.396%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.personalizeevents
Introducing Amazon Personalize - a machine learning service that makes it easy for developers to create individualized recommendations for customers using their applications.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.100 (published about 2 months ago)
- Last Synced: 2026-08-22T21:01:56.258Z (1 day ago)
- Versions: 1,225
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 1,135,643 Total
-
Rankings:
- Downloads: 1.884%
- Average: 12.4%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.route53resolver
This is the first release of the Amazon Route 53 Resolver API. Customers now have the ability to create and manage Amazon Route 53 Resolver endpoints and Amazon Route 53 Resolver rules.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.100 (published about 2 months ago)
- Last Synced: 2026-08-22T21:01:23.381Z (1 day ago)
- Versions: 1,293
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 785,458 Total
-
Rankings:
- Downloads: 1.996%
- Average: 12.437%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.forecastqueryservice
Amazon Forecast is a fully managed machine learning service that makes it easy for customers to generate accurate forecasts using their historical time-series data
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.100 (published about 2 months ago)
- Last Synced: 2026-08-22T21:03:09.915Z (1 day ago)
- Versions: 1,191
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 714,768 Total
-
Rankings:
- Downloads: 2.221%
- Average: 12.512%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.connectparticipant
This release adds 5 new APIs: CreateParticipantConnection, DisconnectParticipant, GetTranscript, SendEvent, and SendMessage. For Amazon Connect chat, you can use them to programmatically perform participant actions on the configured Amazon Connect instance. Learn more here: https://docs.aws.amazon.com/connect-participant/latest/APIReference/Welcome.html
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.100 (published about 2 months ago)
- Last Synced: 2026-08-22T21:03:08.300Z (1 day ago)
- Versions: 1,161
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 674,505 Total
-
Rankings:
- Downloads: 2.259%
- Average: 12.525%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.kinesisvideosignalingchannels
Announcing support for WebRTC in Kinesis Video Streams, as fully managed capability. You can now use simple APIs to enable your connected devices, web, and mobile apps with real-time two-way media streaming capabilities.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.100 (published about 2 months ago)
- Last Synced: 2026-08-22T21:01:38.616Z (1 day ago)
- Versions: 1,149
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 622,332 Total
-
Rankings:
- Downloads: 2.296%
- Average: 12.537%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.imagebuilder
This is the first release of EC2 Image Builder, a service that provides a managed experience for automating the creation of EC2 AMIs.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.100 (published about 2 months ago)
- Last Synced: 2026-08-22T21:02:23.642Z (1 day ago)
- Versions: 1,169
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 623,384 Total
-
Rankings:
- Downloads: 2.354%
- Average: 12.557%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.codestarnotifications
This release adds a notification manager for events in repositories, build projects, deployments, and pipelines. You can now configure rules and receive notifications about events that occur for resources. Each notification includes a status message as well as a link to the resource (repository, build project, deployment application, or pipeline) whose event generated the notification.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.100 (published about 2 months ago)
- Last Synced: 2026-08-22T21:03:35.067Z (1 day ago)
- Versions: 1,162
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 572,925 Total
-
Rankings:
- Downloads: 2.368%
- Average: 12.561%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.extensions.crtintegration
Extensions for the AWS SDK for .NET to integrate with the AWS Common Runtime
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.100 (published about 2 months ago)
- Last Synced: 2026-08-23T05:30:32.882Z (about 19 hours ago)
- Versions: 97
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 8,275,457 Total
-
Rankings:
- Downloads: 2.447%
- Average: 12.587%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.dataexchange
Introducing AWS Data Exchange, a service that makes it easy for AWS customers to securely create, manage, access, and exchange data sets in the cloud.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.100 (published about 2 months ago)
- Last Synced: 2026-08-22T21:03:28.077Z (1 day ago)
- Versions: 1,171
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 813,485 Total
-
Rankings:
- Downloads: 2.45%
- Average: 12.588%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.networkmanager
This is the initial SDK release for AWS Network Manager.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.100 (published about 2 months ago)
- Last Synced: 2026-08-22T21:03:21.873Z (1 day ago)
- Versions: 1,156
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 557,520 Total
-
Rankings:
- Downloads: 2.518%
- Average: 12.611%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.ivs
Introducing Amazon Interactive Video Service - a managed live streaming solution that is quick and easy to set up, and ideal for creating interactive video experiences.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.101 (published about 2 months ago)
- Last Synced: 2026-08-22T21:02:59.897Z (1 day ago)
- Versions: 1,058
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 620,637 Total
-
Rankings:
- Downloads: 2.549%
- Average: 12.621%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.extensions.logging.log4netadaptor
Integrates the AWS SDK for .NET logging into log4net.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.100 (published about 2 months ago)
- Last Synced: 2026-08-22T21:01:38.176Z (1 day ago)
- Versions: 68
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 37,323 Total
-
Rankings:
- Dependent repos count: 6.953%
- Average: 12.803%
- Dependent packages count: 18.654%
- Maintainers (1)
nuget.org: awssdk.emrcontainers
This release adds support for Amazon EMR on EKS, a simple way to run Spark on Kubernetes.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.103 (published 27 days ago)
- Last Synced: 2026-08-22T21:01:30.699Z (1 day ago)
- Versions: 989
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 391,141 Total
-
Rankings:
- Downloads: 3.301%
- Average: 12.872%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.prometheusservice
(New Service) Amazon Managed Service for Prometheus is a fully managed Prometheus-compatible monitoring service that makes it easy to monitor containerized applications securely and at scale.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.102 (published 23 days ago)
- Last Synced: 2026-08-22T21:02:59.183Z (1 day ago)
- Versions: 992
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 393,727 Total
-
Rankings:
- Downloads: 3.388%
- Average: 12.901%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.lookoutforvision
This release introduces support for Amazon Lookout for Vision.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.2 (published 10 months ago)
- Last Synced: 2026-08-22T21:03:23.712Z (1 day ago)
- Versions: 882
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 370,603 Total
-
Rankings:
- Downloads: 3.395%
- Average: 12.904%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.cloudcontrolapi
Initial release of the SDK for AWS Cloud Control API
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.100 (published about 2 months ago)
- Last Synced: 2026-08-22T21:02:27.951Z (1 day ago)
- Versions: 877
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 603,271 Total
-
Rankings:
- Downloads: 3.751%
- Average: 13.022%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.finspace
This is the initial SDK release for the management APIs for Amazon FinSpace. Amazon FinSpace is a data management and analytics service for the financial services industry (FSI).
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.100 (published about 2 months ago)
- Last Synced: 2026-08-22T21:03:13.332Z (1 day ago)
- Versions: 942
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 382,621 Total
-
Rankings:
- Downloads: 3.782%
- Average: 13.033%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.migrationhubstrategyrecommendations
AWS SDK for Migration Hub Strategy Recommendations. It includes APIs to start the portfolio assessment, import portfolio data for assessment, and to retrieve recommendations. For more information, see the AWS Migration Hub documentation at https://docs.aws.amazon.com/migrationhub/index.html
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.100 (published about 2 months ago)
- Last Synced: 2026-08-22T21:03:32.891Z (1 day ago)
- Versions: 854
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 315,581 Total
-
Rankings:
- Downloads: 4.337%
- Average: 13.218%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.migrationhubrefactorspaces
This is the initial SDK release for AWS Migration Hub Refactor Spaces
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.100 (published about 2 months ago)
- Last Synced: 2026-08-22T21:02:30.753Z (1 day ago)
- Versions: 852
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 318,862 Total
-
Rankings:
- Downloads: 4.379%
- Average: 13.231%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.extensions.cloudfront.signers
This package contains extension methods for creating signed URLs for Amazon CloudFront distributions and for creating signed cookies for Amazon CloudFront distributions using canned or custom policies.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.101 (published 2 days ago)
- Last Synced: 2026-08-22T09:14:00.399Z (1 day ago)
- Versions: 79
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 1,492,046 Total
-
Rankings:
- Dependent repos count: 7.342%
- Average: 13.52%
- Dependent packages count: 19.698%
- Maintainers (1)
nuget.org: awssdk.supportapp
This is the initial SDK release for the AWS Support App in Slack.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.100 (published about 2 months ago)
- Last Synced: 2026-08-22T21:02:10.909Z (1 day ago)
- Versions: 759
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 232,781 Total
-
Rankings:
- Downloads: 5.841%
- Average: 13.719%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.iotroborunner
AWS IoT RoboRunner is a new service that makes it easy to build applications that help multi-vendor robots work together seamlessly. See the IoT RoboRunner developer guide for more details on getting started. https://docs.aws.amazon.com/iotroborunner/latest/dev/iotroborunner-welcome.html
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 3.7.300 (published almost 3 years ago)
- Last Synced: 2026-08-22T21:02:41.166Z (1 day ago)
- Versions: 259
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 91,236 Total
-
Rankings:
- Downloads: 7.814%
- Average: 14.377%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.oam
Amazon CloudWatch Observability Access Manager is a new service that allows configuration of the CloudWatch cross-account observability feature.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.100 (published about 2 months ago)
- Last Synced: 2026-08-22T21:02:09.792Z (1 day ago)
- Versions: 705
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 194,785 Total
-
Rankings:
- Downloads: 7.962%
- Average: 14.426%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.sagemakermetrics
This release introduces support SageMaker Metrics APIs.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.100 (published about 2 months ago)
- Last Synced: 2026-08-22T21:02:17.989Z (1 day ago)
- Versions: 695
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 178,230 Total
-
Rankings:
- Downloads: 8.098%
- Average: 14.471%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.securitylake
Amazon Security Lake automatically centralizes security data from cloud, on-premises, and custom sources into a purpose-built data lake stored in your account. Security Lake makes it easier to analyze security data, so you can improve the protection of your workloads, applications, and data
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.100 (published about 2 months ago)
- Last Synced: 2026-08-22T21:02:35.024Z (1 day ago)
- Versions: 701
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 181,225 Total
-
Rankings:
- Downloads: 8.129%
- Average: 14.482%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.licensemanagerlinuxsubscriptions
AWS License Manager now offers cross-region, cross-account tracking of commercial Linux subscriptions on AWS. This includes subscriptions purchased as part of EC2 subscription-included AMIs, on the AWS Marketplace, or brought to AWS via Red Hat Cloud Access Program.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.100 (published about 2 months ago)
- Last Synced: 2026-08-22T21:03:23.927Z (1 day ago)
- Versions: 684
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 175,910 Total
-
Rankings:
- Downloads: 8.532%
- Average: 14.616%
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.internetmonitor
CloudWatch Internet Monitor is a a new service within CloudWatch that will help application developers and network engineers continuously monitor internet performance metrics such as availability and performance between their AWS-hosted applications and end-users of these applications
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.100 (published about 2 months ago)
- Last Synced: 2026-08-22T21:02:29.252Z (1 day ago)
- Versions: 648
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 150,101 Total
-
Rankings:
- Downloads: 11.148%
- Dependent repos count: 14.978%
- Average: 15.488%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.paymentcryptography
Initial release of AWS Payment Cryptography Control Plane service for creating and managing cryptographic keys used during card payment processing.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.100 (published about 2 months ago)
- Last Synced: 2026-08-22T21:03:05.380Z (1 day ago)
- Versions: 593
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 293,238 Total
-
Rankings:
- Downloads: 14.578%
- Dependent repos count: 14.978%
- Average: 16.631%
- Dependent packages count: 20.338%
- Maintainers (1)
nuget.org: awssdk.bcmrecommendedactions
Initial SDK release for AWS Billing and Cost Management Recommended Actions.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.102 (published 24 days ago)
- Last Synced: 2026-08-22T21:02:25.703Z (1 day ago)
- Versions: 159
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 27,943 Total
-
Rankings:
- Forks count: 1.129%
- Dependent repos count: 6.685%
- Stargazers count: 10.242%
- Dependent packages count: 17.92%
- Average: 18.555%
- Downloads: 56.797%
- Maintainers (1)
nuget.org: awssdk.bedrockagentruntime
This release introduces Agents for Amazon Bedrock Runtime
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.102 (published 6 days ago)
- Last Synced: 2026-08-22T21:02:26.282Z (1 day ago)
- Versions: 513
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 1,934,869 Total
-
Rankings:
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Average: 20.423%
- Downloads: 25.952%
- Maintainers (1)
nuget.org: awssdk.cloudfrontkeyvaluestore
This release adds support for CloudFront KeyValueStore, a globally managed key value datastore associated with CloudFront Functions.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.100 (published about 2 months ago)
- Last Synced: 2026-08-22T21:01:44.615Z (1 day ago)
- Versions: 497
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 275,976 Total
-
Rankings:
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Average: 20.587%
- Downloads: 26.447%
- Maintainers (1)
nuget.org: awssdk.repostspace
Initial release of AWS re:Post Private
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.100 (published about 2 months ago)
- Last Synced: 2026-08-22T21:02:04.145Z (1 day ago)
- Versions: 493
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 106,367 Total
-
Rankings:
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Average: 20.764%
- Downloads: 26.977%
- Maintainers (1)
nuget.org: awssdk.qconnect
Amazon Q in Connect, an LLM-enhanced evolution of Amazon Connect Wisdom. This release adds generative AI support to Amazon Q Connect QueryAssistant and GetRecommendations APIs.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.100 (published about 2 months ago)
- Last Synced: 2026-08-22T21:02:19.859Z (1 day ago)
- Versions: 504
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 115,784 Total
-
Rankings:
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Average: 21.073%
- Downloads: 27.902%
- Maintainers (1)
nuget.org: awssdk.qbusiness
Amazon Q - a generative AI powered application that your employees can use to ask questions and get answers from knowledge spread across disparate content repositories, summarize reports, write articles, take actions, and much more - all within their company's connected content repositories.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.100 (published about 2 months ago)
- Last Synced: 2026-08-22T21:01:52.389Z (1 day ago)
- Versions: 501
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 131,695 Total
-
Rankings:
- Dependent repos count: 14.978%
- Dependent packages count: 20.338%
- Average: 21.23%
- Downloads: 28.375%
- Maintainers (1)
nuget.org: awssdk.sagemakerjobruntime
Amazon SageMaker Job Runtime is a new service for managing trajectory data during multi-turn customization jobs. It provides APIs to send inference requests to models during job execution, mark rollouts as complete, and submit reward values for training trajectories.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.100 (published about 2 months ago)
- Last Synced: 2026-08-22T21:02:38.826Z (1 day ago)
- Versions: 20
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 2,861 Total
-
Rankings:
- Dependent repos count: 5.936%
- Dependent packages count: 15.866%
- Average: 26.083%
- Downloads: 56.447%
- Maintainers (1)
nuget.org: awssdk.resiliencehubv2
This is the initial SDK release for the next generation of Resilience Hub.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.102 (published 23 days ago)
- Last Synced: 2026-08-22T21:02:09.264Z (1 day ago)
- Versions: 23
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 3,199 Total
-
Rankings:
- Dependent repos count: 5.95%
- Dependent packages count: 15.903%
- Average: 26.096%
- Downloads: 56.437%
- Maintainers (1)
nuget.org: awssdk.signerdata
This release introduces AWS Signer Data Plane SDK client supporting GetRevocationStatus API. The new client enables AWS PrivateLink connectivity with both private DNS and VPC endpoint URLs.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.100 (published about 2 months ago)
- Last Synced: 2026-08-22T21:01:28.709Z (1 day ago)
- Versions: 57
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 6,908 Total
-
Rankings:
- Dependent repos count: 6.213%
- Dependent packages count: 16.594%
- Average: 26.362%
- Downloads: 56.278%
- Maintainers (1)
nuget.org: awssdk.mwaaserverless
Amazon MWAA now offers serverless deployment, eliminating operational overhead while optimizing costs. The service supports YAML and Python-based workflows, with 80+ AWS Operators. It provides isolated execution, IAM permissions, and automatic scaling with pay-per-use pricing.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.101 (published 9 days ago)
- Last Synced: 2026-08-22T21:03:13.267Z (1 day ago)
- Versions: 105
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 17,323 Total
-
Rankings:
- Dependent repos count: 6.509%
- Dependent packages count: 17.459%
- Average: 26.994%
- Downloads: 57.013%
- Maintainers (1)
nuget.org: awssdk.bcmdashboards
Billing and Cost Management Dashboards enables users to create dashboards that combine multiple visualizations of cost and usage data. Users can create, manage, and share dashboards. Tags are also available for dashboards.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.100 (published about 2 months ago)
- Last Synced: 2026-08-22T21:02:12.103Z (1 day ago)
- Versions: 160
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 27,607 Total
-
Rankings:
- Dependent repos count: 6.679%
- Dependent packages count: 17.907%
- Average: 27.129%
- Downloads: 56.799%
- Maintainers (1)
nuget.org: awssdk.mpa
This release enables customers to create Multi-party approval teams and approval requests to protect supported operations.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.100 (published about 2 months ago)
- Last Synced: 2026-08-22T21:01:27.618Z (1 day ago)
- Versions: 197
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 39,509 Total
-
Rankings:
- Dependent repos count: 6.765%
- Dependent packages count: 18.149%
- Average: 27.179%
- Downloads: 56.622%
- Maintainers (1)
nuget.org: awssdk.notifications
This release adds support for AWS User Notifications. You can now configure and view notifications from AWS services in a central location using the AWS SDK.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.100 (published about 2 months ago)
- Last Synced: 2026-08-22T21:02:04.079Z (1 day ago)
- Versions: 324
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 65,076 Total
-
Rankings:
- Dependent repos count: 7.38%
- Dependent packages count: 19.796%
- Average: 28.256%
- Downloads: 57.593%
- Maintainers (1)
nuget.org: awssdk.observabilityadmin
Amazon CloudWatch Observability Admin adds the ability to audit telemetry configuration for AWS resources in customers AWS Accounts and Organizations. The release introduces new APIs to turn on/off the new experience, which supports discovering supported AWS resources and their state of telemetry.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.104 (published 9 days ago)
- Last Synced: 2026-08-22T21:02:40.938Z (1 day ago)
- Versions: 333
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 64,646 Total
-
Rankings:
- Dependent repos count: 7.368%
- Dependent packages count: 19.767%
- Average: 28.264%
- Downloads: 57.655%
- Maintainers (1)
nuget.org: awssdk.bedrockdataautomation
Release Bedrock Data Automation SDK
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.100 (published about 2 months ago)
- Last Synced: 2026-08-20T19:18:26.479Z (3 days ago)
- Versions: 325
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 119,085 Total
-
Rankings:
- Dependent repos count: 7.355%
- Dependent packages count: 19.732%
- Average: 28.27%
- Downloads: 57.722%
- Maintainers (1)
nuget.org: awssdk.networkflowmonitor
This release adds documentation for a new feature in Amazon CloudWatch called Network Flow Monitor. You can use Network Flow Monitor to get near real-time metrics, including retransmissions and data transferred, for your actual workloads.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.100 (published about 2 months ago)
- Last Synced: 2026-08-22T21:02:11.477Z (1 day ago)
- Versions: 323
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 63,915 Total
-
Rankings:
- Dependent repos count: 7.361%
- Dependent packages count: 19.748%
- Average: 28.272%
- Downloads: 57.707%
- Maintainers (1)
nuget.org: awssdk.mailmanager
This release includes a new Amazon SES feature called Mail Manager, which is a set of email gateway capabilities designed to help customers strengthen their organization's email infrastructure, simplify email workflow management, and streamline email compliance control.
- Homepage: https://github.com/aws/aws-sdk-net/
- Licenses: Apache-2.0
- Latest release: 4.0.101 (published about 2 months ago)
- Last Synced: 2026-08-22T21:02:08.091Z (1 day ago)
- Versions: 415
- Dependent Packages: 0
- Dependent Repositories: 0
- Downloads: 92,003 Total
-
Rankings:
- Dependent repos count: 7.714%
- Dependent packages count: 20.693%
- Average: 28.478%
- Downloads: 57.028%
- Maintainers (1)
Dependencies
- Microsoft.NET.Test.Sdk 17.5.0
- NUnit3TestAdapter 4.4.2
- nunit 3.13.3
- xunit 2.4.1
- xunit.assert 2.4.1
- xunit.extensibility.core 2.4.1
- xunit.runner.visualstudio 2.4.1
- Microsoft.Extensions.AI.Abstractions 10.5.1
- Microsoft.Build.Framework 16.11.0
- Microsoft.Build.Utilities.Core 16.11.0
- Newtonsoft.Json 13.0.3
- log4net 3.3.0
- aws-actions/closed-issue-message cf797c2463fa6b95a23b2957fe075a3fa9aa8138 composite
- aws-github-ops/handle-stale-discussions c0beee451a5d33d9c8f048a6d4e7c856b5422544 composite
- aws-actions/stale-issue-cleanup 7de35968489e4142233d2a6812519a82e68b5c38 composite
- Microsoft.NET.Test.Sdk 17.7.2
- Moq 4.8.2
- xunit 2.4.2
- xunit.runner.visualstudio 2.4.5
- Microsoft.NET.Test.Sdk 15.9.0
- xunit 2.4.2
- xunit.runner.visualstudio 2.4.5
- actions/github-script f28e40c7f34bde8b3046d885e986cb6290c5673b composite
- aws-actions/configure-aws-credentials 517a711dbcd0e402f90c77e7e2f81e849156e31d composite
- FuzzySharp 2.0.2
- Spectre.Console 0.50.0
- Spectre.Console.Cli 0.50.0
- Microsoft.NET.Test.Sdk 17.5.0
- NUnit3TestAdapter 4.4.2
- nunit 3.13.3
- xunit.runner.visualstudio 2.8.2 development
- Microsoft.CSharp 4.7.0
- Microsoft.NET.Test.Sdk 17.11.1
- System.Data.DataSetExtensions 4.5.0
- xunit 2.9.2
- xunit.abstractions 2.0.3
- xunit.assert 2.9.2
- xunit.core 2.9.2
- xunit.extensibility.core 2.9.2
- xunit.extensibility.execution 2.9.2
- BouncyCastle.Cryptography 2.6.2
- Microsoft.Extensions.Configuration.Abstractions 2.0.0
- Microsoft.Extensions.DependencyInjection.Abstractions 2.0.0
- Microsoft.Extensions.Logging.Abstractions 2.0.0
- BouncyCastle.Cryptography 2.6.2
- Microsoft.NET.Test.Sdk 17.7.2
- xunit 2.4.2
- xunit.runner.visualstudio 2.4.5
- Microsoft.AspNetCore.SystemWebAdapters 1.3.0
- Microsoft.CSharp 4.7.0
- System.Data.DataSetExtensions 4.5.0
- System.Runtime.Loader 4.3.0
- System.Text.Json 10.0.1
- Microsoft.Extensions.AI.Abstractions 10.5.1
- AWSCRT-AUTH 0.6.0
- AWSCRT-CHECKSUMS 0.6.0
- AWSCRT-AUTH 0.6.0
- AWSCRT-CHECKSUMS 0.6.0
- BouncyCastle.Cryptography 2.6.2
- System.Formats.Cbor 9.0.5
- Microsoft.Extensions.Configuration 2.0.0
- Microsoft.Extensions.Configuration.Json 2.0.0
- Microsoft.Extensions.DependencyInjection 2.0.0
- Microsoft.NET.Test.Sdk 17.7.2
- Moq 4.8.2
- xunit 2.4.2
- xunit.runner.visualstudio 2.4.5
- Microsoft.CodeAnalysis.Analyzers 2.6.2
- Microsoft.CodeAnalysis.CSharp.Workspaces 2.10
- xunit.runner.visualstudio 2.4.1 development
- MSTest.TestAdapter 1.3.2
- MSTest.TestFramework 1.3.2
- Microsoft.CodeAnalysis.Analyzers 2.6.2
- Microsoft.CodeAnalysis.CSharp.Workspaces 2.10
- Microsoft.NET.Test.Sdk 15.9.0
- xunit 2.4.1
- AWSSDK.Core 3.7.106.21
- Microsoft.Build.Framework 16.11.0
- Microsoft.Build.Utilities.Core 16.11.0
- BouncyCastle.Cryptography 2.6.2
- System.Text.Json $(SystemTextJsonVersion)
- AWSSDK.CloudWatch 4.0.1.3
- AWSSDK.DynamoDBv2 4.0.1.5
- AWSSDK.Route53 4.0.1.2
- AWSSDK.S3 4.0.1.5
- AWSSDK.SQS 4.0.0.8
- AWSSDK.SecurityToken 4.0.0.7
- AWSSDK.SimpleEmail 4.0.0.7
- AWSSDK.SimpleNotificationService 4.0.0.7
- actions/github-script 60a0d83039c74a4aee543508d2ffcb1c3799cdea composite
- BouncyCastle.Cryptography 2.6.2
- Microsoft.Extensions.Logging.Abstractions 8.0.3
- Microsoft.Extensions.AI.Abstractions 10.5.1
- Microsoft.NET.Test.Sdk 17.11.1
- Moq 4.8.3
- xunit 2.9.2
- xunit.runner.visualstudio 2.8.2
- xunit.runner.visualstudio 3.1.1 development
- Microsoft.NET.Test.Sdk 17.14.1
- xunit 2.9.3
- Microsoft.CodeAnalysis.CSharp.Workspaces 5.0.0
- Microsoft.NET.Test.Sdk 18.5.0
- xunit.runner.visualstudio 3.1.5
- xunit.v3 3.2.2
- Microsoft.NET.Test.Sdk 17.5.0
- Moq 4.18.4
- NUnit 3.13.3
- NUnit.Analyzers 3.6.1
- NUnit3TestAdapter 4.4.2
- coverlet.collector 3.2.0
- BouncyCastle.Cryptography 2.6.2
- xunit.runner.visualstudio 2.4.5 development
- Microsoft.NET.Test.Sdk 17.7.2
- xunit 2.4.2
- actions/checkout 34e114876b0b11c390a56381ad16ebd13914f8d5 composite
- actions/github-script 60a0d83039c74a4aee543508d2ffcb1c3799cdea composite
- Microsoft.CSharp 4.4.1
- System.CodeDom 6.0.0
- xunit.runner.visualstudio 2.8.2 development
- Microsoft.NET.Test.Sdk 17.11.1
- Microsoft.TestPlatform.TestHost 17.11.1
- Moq 4.20.72
- Should-DotNetStandard 1.0.0
- xunit 2.9.2
- Microsoft.CSharp 4.7.0
- System.Data.DataSetExtensions 4.5.0
- System.Formats.Cbor 9.0.5